SecReT6
Protein ID: 383785510
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2278
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2340217..2341251 [+]
Producthypothetical protein
NoteTssG
UniProt IDI0IRQ1
KEGG IDlfc:LFE_2278
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.10E-69, Aligned region: 24..321
Protein Sequence: 344 a.a.     [Download]
>gi|383785510|ref|YP_005470080.1| hypothetical protein LFE_2278 [Leptospirillum ferrooxidans C2-3]
MARAAGHTDTDLIALKKALEEDGDQYSFTQVIRLLRLVLKKTDDRFAPEDFWERIRIRPALALGFPHMDI
DTIKWGAEGKTALLDVNFFGLYGVSSPLPTFYTEDLIDYQNNDNTAPRDFLDIIHGALYPLLYDSWKKHR
LSLRAYEDEEESVLEWFHTFTGLSDSLFREGDPLYATTLRYAGLLTQHPRSAKALESILSDVLGQVPVTV
EQCPEKTVPIPKDQLLILGKSLRLGEETVLGETLTDRINQIRIRVGPVENDGFDRLLPGNEDLEKVAFWY
RFYLIEPVMADIEIILSDQSPRPICLGDRVRTRLGLDSWLENGSHTSRKHVVFSLHANEMEGDL
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2340217-2341251 Leptospirillum ferrooxidans C2-3, complete genome
ATGGCCCGAGCGGCTGGGCACACAGACACTGATCTGATCGCTCTCAAGAAGGCCCTGGAAGAGGACGGAG
ACCAATACAGCTTTACCCAGGTCATCCGGCTTCTTCGGCTCGTTCTGAAGAAAACCGACGATCGATTTGC
CCCGGAGGATTTCTGGGAACGGATCCGGATCAGACCGGCGCTCGCCCTGGGATTTCCCCATATGGATATC
GATACCATCAAATGGGGAGCTGAGGGCAAAACAGCGCTTCTGGACGTGAACTTCTTTGGACTTTACGGCG
TCTCCTCGCCTCTCCCGACCTTCTACACCGAAGACCTGATCGATTATCAGAACAATGACAACACCGCCCC
CAGGGACTTTCTGGACATCATTCATGGGGCCCTGTACCCCCTTCTCTACGACTCCTGGAAAAAACACCGG
CTGTCGCTACGCGCCTACGAAGATGAAGAGGAAAGCGTCCTCGAGTGGTTTCATACCTTTACGGGCCTTT
CAGACTCCCTCTTCCGGGAAGGCGACCCGCTCTACGCGACAACCCTTCGTTATGCCGGCCTTCTCACACA
GCATCCCCGGTCGGCAAAAGCTCTGGAATCGATCCTCTCCGATGTCCTCGGCCAAGTCCCGGTCACCGTC
GAACAATGTCCGGAAAAAACCGTTCCCATCCCGAAAGACCAGTTGTTGATCCTGGGAAAATCCCTTCGTC
TTGGAGAGGAGACCGTTCTGGGTGAAACGCTCACCGACCGGATCAACCAGATCCGGATACGGGTCGGACC
GGTGGAGAACGATGGCTTCGACCGGCTTCTCCCCGGCAACGAAGACCTTGAAAAGGTCGCCTTCTGGTAT
CGCTTTTATCTGATCGAACCGGTCATGGCGGATATCGAGATCATTCTCTCGGACCAATCACCCAGACCGA
TCTGTCTTGGAGATCGTGTCCGAACGAGGCTGGGACTCGACTCATGGCTCGAAAACGGATCCCACACCTC
CCGGAAACATGTTGTTTTTTCGCTCCACGCCAACGAAATGGAAGGGGACTTATGA
 Primer design