SecReT6
Protein ID: 383785511
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2279
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2341248..2343908 [+]
ProductATPase AAA2 domain protein
NoteTssH
UniProt IDI0IRQ2
KEGG IDlfc:LFE_2279
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.10E-41, Aligned region: 219..236
AAA_2 [PF07724], Evalue: 6.10E-41, Aligned region: 513..562
AAA_2 [PF07724], Evalue: 6.10E-41, Aligned region: 604..769
AAA [PF00004], Evalue: 3.90E-19, Aligned region: 220..331
AAA [PF00004], Evalue: 3.90E-19, Aligned region: 609..692
AAA [PF00004], Evalue: 3.90E-19, Aligned region: 768..831
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 55..81
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 196..238
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 260..297
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 599..647
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 673..699
AAA_16 [PF13191], Evalue: 2.10E-14, Aligned region: 767..794
AAA_5 [PF07728], Evalue: 8.40E-13, Aligned region: 55..109
AAA_5 [PF07728], Evalue: 8.40E-13, Aligned region: 221..239
AAA_5 [PF07728], Evalue: 8.40E-13, Aligned region: 319..349
AAA_5 [PF07728], Evalue: 8.40E-13, Aligned region: 608..728
ClpB_D2-small [PF10431], Evalue: 4.90E-10, Aligned region: 463..487
ClpB_D2-small [PF10431], Evalue: 4.90E-10, Aligned region: 515..547
ClpB_D2-small [PF10431], Evalue: 4.90E-10, Aligned region: 775..846
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 218..304
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 606..628
Sigma54_activat [PF00158], Evalue: 8.90E-05, Aligned region: 219..277
Sigma54_activat [PF00158], Evalue: 8.90E-05, Aligned region: 607..725
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 216..241
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 606..626
Clp_N [PF02861], Evalue: 0.00018, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.00018, Aligned region: 306..316
AAA_25 [PF13481], Evalue: 0.00036, Aligned region: 219..243
AAA_25 [PF13481], Evalue: 0.00036, Aligned region: 276..313
AAA_25 [PF13481], Evalue: 0.00036, Aligned region: 606..626
IstB_IS21 [PF01695], Evalue: 0.00052, Aligned region: 210..242
IstB_IS21 [PF01695], Evalue: 0.00052, Aligned region: 608..626
Zeta_toxin [PF06414], Evalue: 0.00099, Aligned region: 219..236
Zeta_toxin [PF06414], Evalue: 0.00099, Aligned region: 601..649
AAA_14 [PF13173], Evalue: 0.0018, Aligned region: 222..300
AAA_14 [PF13173], Evalue: 0.0018, Aligned region: 363..400
AAA_14 [PF13173], Evalue: 0.0018, Aligned region: 607..689
DUF258 [PF03193], Evalue: 0.005, Aligned region: 184..238
DUF258 [PF03193], Evalue: 0.005, Aligned region: 607..619
AAA_17 [PF13207], Evalue: 0.0054, Aligned region: 222..243
AAA_17 [PF13207], Evalue: 0.0054, Aligned region: 607..628
NACHT [PF05729], Evalue: 0.0082, Aligned region: 220..246
NACHT [PF05729], Evalue: 0.0082, Aligned region: 608..628
Protein Sequence: 886 a.a.     [Download]
>gi|383785511|ref|YP_005470081.1| ATPase AAA2 domain protein [Leptospirillum ferrooxidans C2-3]
MIIAELKPLFRRLNTVLTLSLEQGAGLCLSKTHYEITAEHILYSLLSKPGCDMARILEHRNIAPEQVRRE
LSDAMEDFRSGNGGRPVFSPLLIELIQDAHIISSINRGEPKIRSGALLQAFLNRIGYFSSGRVSRSLEQI
PKDALADHFDELTAGSSEQTAAPEGERKEEGAESTAIGRFCEDFTEKARQNKIDPVFGRDQEVRQIIDIL
SRRRKNNPICVGDPGVGKTAVVESLALRIVTGDVPESLSKVRLLGLDLGALEAGAGVKGEFENRLKGVIN
EIRSSPTPVILFIDEAHTLIGAGGAQGGGDAANLLKPALARGELRTIAATTWVEYKKYFEKDAALARRFQ
PVKLEEPSIETTILILRGLKEHYEQVHKVAIRDDALIAAAKFSDRYIIGRKLPDKAVDLLDTSAARTKVS
LSGKPERVESLERKIQALEREAKGLRRDEAFGHPVPAGRIGEIEKMLKDLSNSLESEKSLWEKEREAVGS
FLAHRNTFAREGSESDASSSGDWKKELRNQENRLREVQGENPMIRFEVDPETVAKVVSDWTGIPLGKLLR
EQAQTVSRLQENLGKRVMGQDAALSRVSEIIQNAQVGFKSPHQPIGVFLLVGPSGVGKTETALTVADILF
GDEKATVTINMSEFQEKHQVSRLIGSPPGYVGFGEGGVLTEAVRQRPYSVVLLDEIEKAHPDIPNLFYQV
FDKGVLADGEGKEIDFSNTVIFLTSNLASGQLTAYATDHPEAGYEELVNLIRPELSRHFKPALLARMTIV
PYLPLKGESLGRIVRLKTARLSQTFAQNNQAEILFEDSLIAHLSDQCEASEAGARNIDYLLQSRILPEIS
RKLIGRLADGTLSGKIRVGISPDATMTILWDDEESPVSRKTTKRKG
 
Nucleotide Sequence: 2661 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2341248-2343908 Leptospirillum ferrooxidans C2-3, complete genome
ATGATCATTGCAGAGCTGAAACCGCTTTTCAGACGGCTGAACACGGTCCTGACCCTCTCACTCGAGCAGG
GCGCGGGACTCTGTCTTTCTAAGACCCACTACGAGATCACCGCGGAGCATATCCTGTACTCCCTCCTCTC
GAAACCGGGTTGCGACATGGCGAGGATCCTCGAACACAGGAACATCGCCCCGGAACAGGTCCGCCGGGAG
CTGTCAGACGCCATGGAGGATTTTCGCTCCGGAAACGGTGGACGCCCTGTCTTCTCCCCCCTCCTGATCG
AACTGATCCAGGATGCCCATATCATCTCTTCCATCAACCGGGGGGAGCCGAAAATACGCTCCGGAGCCCT
TCTCCAGGCGTTTCTGAACCGGATCGGCTATTTCTCTTCCGGAAGAGTCTCCCGCTCCCTCGAGCAGATC
CCCAAAGATGCCCTTGCCGACCATTTCGATGAGCTCACCGCCGGATCGAGCGAGCAAACGGCCGCTCCGG
AAGGAGAGAGGAAAGAGGAAGGCGCCGAATCCACCGCCATCGGACGGTTCTGCGAGGACTTCACCGAAAA
GGCCCGCCAGAACAAGATCGATCCGGTCTTCGGACGGGACCAGGAGGTTCGGCAGATCATCGATATCCTC
TCCAGGAGAAGAAAGAACAACCCGATCTGCGTGGGCGACCCAGGGGTTGGCAAAACGGCGGTCGTCGAAA
GTCTCGCCTTGAGAATCGTCACCGGAGACGTTCCCGAATCCCTTTCGAAGGTTAGACTCCTCGGACTCGA
CCTCGGCGCTCTCGAAGCCGGAGCCGGCGTCAAGGGAGAGTTCGAGAATCGTCTGAAAGGCGTCATCAAT
GAAATCCGCTCCTCCCCCACCCCCGTCATCCTGTTTATCGACGAAGCCCACACCCTGATCGGAGCCGGAG
GCGCCCAGGGGGGCGGGGATGCCGCCAATCTCCTGAAACCCGCCCTCGCCCGGGGAGAACTTCGGACCAT
TGCCGCCACAACCTGGGTCGAATACAAGAAGTACTTCGAAAAAGATGCCGCCCTCGCCAGGCGATTCCAG
CCGGTCAAGCTTGAAGAACCCTCCATTGAAACGACGATCCTGATCCTCCGGGGGCTCAAGGAACACTACG
AACAGGTCCACAAGGTCGCGATCCGGGACGACGCCCTGATTGCCGCCGCCAAGTTTTCCGACCGCTACAT
CATCGGCAGGAAACTCCCCGACAAGGCGGTGGATCTACTCGATACCAGCGCGGCCCGAACCAAAGTCTCC
CTTTCCGGAAAACCCGAACGGGTCGAAAGCCTCGAACGCAAGATCCAGGCCCTCGAACGGGAGGCGAAAG
GACTCCGCCGCGATGAGGCCTTCGGCCATCCGGTTCCGGCAGGGCGAATCGGCGAGATCGAAAAAATGCT
CAAGGATCTGTCGAACTCCCTGGAATCGGAAAAATCACTTTGGGAGAAAGAAAGGGAGGCGGTTGGAAGT
TTTCTGGCCCATCGGAATACGTTTGCCCGGGAAGGCTCGGAGTCCGACGCTTCATCCTCCGGTGACTGGA
AAAAAGAGCTCAGGAATCAGGAGAACCGGCTTCGGGAGGTTCAGGGAGAAAATCCGATGATCCGCTTTGA
AGTCGATCCTGAAACAGTCGCAAAGGTCGTATCGGACTGGACAGGGATCCCCCTCGGAAAGCTTCTTCGG
GAACAGGCCCAGACCGTTTCCCGACTGCAGGAAAACCTCGGCAAACGGGTCATGGGACAGGATGCGGCAC
TCTCCCGTGTCAGCGAGATCATCCAGAACGCCCAGGTCGGCTTCAAAAGCCCACACCAGCCCATTGGCGT
CTTTCTTCTGGTCGGTCCCAGCGGGGTGGGAAAAACAGAAACCGCTCTCACCGTCGCCGACATCCTTTTC
GGAGACGAAAAAGCCACGGTAACGATCAACATGAGCGAATTCCAGGAAAAGCATCAGGTCAGCAGGCTGA
TCGGCTCGCCACCCGGATATGTGGGGTTCGGTGAAGGAGGCGTCCTGACCGAAGCGGTCCGGCAGCGTCC
GTACTCCGTGGTGTTGCTCGACGAAATCGAAAAAGCCCATCCCGACATTCCCAATCTTTTCTATCAGGTC
TTCGACAAGGGAGTCCTCGCCGACGGGGAGGGAAAGGAAATCGATTTTTCCAACACCGTGATCTTTCTGA
CCAGCAATCTTGCCTCCGGACAGTTGACCGCCTATGCGACAGACCACCCGGAAGCCGGATATGAAGAGCT
GGTAAACCTCATCCGTCCCGAACTCTCAAGACATTTCAAGCCGGCCCTTCTGGCCAGGATGACCATCGTT
CCCTATCTTCCCCTCAAGGGAGAATCCCTCGGGCGGATCGTCCGTCTGAAAACGGCGCGGCTGAGCCAGA
CATTCGCCCAGAACAACCAGGCCGAAATCCTGTTCGAAGACTCCCTGATCGCCCATCTTTCCGATCAGTG
CGAGGCCTCCGAAGCCGGTGCACGAAACATCGACTACCTTCTCCAGAGCCGGATCCTTCCCGAAATTTCC
CGAAAACTCATCGGCCGGCTCGCCGACGGAACCCTGTCGGGCAAAATCCGTGTCGGCATCTCTCCCGATG
CCACGATGACGATCCTGTGGGATGACGAAGAAAGCCCGGTCTCCCGTAAAACGACCAAAAGGAAAGGGTA
G
 Primer design