SecReT6
Protein ID: 383785512
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2280
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2343914..2345416 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDI0IRQ3
KEGG IDlfc:LFE_2280
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.60E-52, Aligned region: 31..334
Phage_base_V [PF04717], Evalue: 9.70E-19, Aligned region: 396..475
Protein Sequence: 500 a.a.     [Download]
>gi|383785512|ref|YP_005470082.1| Rhs element Vgr protein [Leptospirillum ferrooxidans C2-3]
MPPEEAGHLSFALSVEGFAREDFSVVDFSGREAMNELFSFRIRLVCEKQDIDPDNTLGRPVTFRIDSSRD
GTHSTTPYHGTFSEFRVLHQAIPYTFYEAVLVPRAHMLTRSMISEVYTSEKGIPDILEDLLKAEGLTSQD
YSFGMSESYRSRSFVCRFEESALSFVDRWAEREGIAYYFDHDDHKDRLVFFDHPSRKPSWKKSLSYRPPS
ELDPGFSDDSLQEWSLRIVPLPHRIVVSDFNYRKANLEIEESRILDPRGKGTVRAFGENTRTNAEAQRQA
TILSEIHKVREKTCEGKTTATGIRAATTVHIKHHFRNDHNGTFFVTSVLHKGSQAAFLTSGFDVRSPKEQ
RQTHYEATFVAIPSDVAFRPQRTTPWPRIPGVSSAIIEAEGSGLFAELSEYGEYKVRFPFIFGQKRSQKN
SGWIRMATPLAGADNGMHFPLHKETEVMVAFLGGDPDQPVILGAVHNSEHRALITNKNPGINVIRSIGGH
SITLNDDGYA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2343914-2345416 Leptospirillum ferrooxidans C2-3, complete genome
ATGCCACCAGAAGAAGCCGGTCACCTCTCATTTGCCCTGTCAGTCGAAGGATTTGCCCGGGAAGATTTTT
CGGTTGTCGATTTTTCGGGACGGGAAGCCATGAACGAGCTGTTTTCCTTCCGGATCCGGCTTGTCTGTGA
AAAACAGGACATCGATCCGGACAATACCCTGGGCCGGCCAGTCACCTTCCGGATAGACTCCTCCCGGGAC
GGCACCCACTCCACCACCCCCTACCACGGGACATTCTCCGAATTCAGGGTCCTGCACCAGGCAATCCCCT
ACACCTTCTACGAAGCCGTTCTGGTTCCCAGGGCCCACATGCTGACCCGTTCCATGATCTCCGAGGTCTA
CACCTCGGAAAAAGGCATCCCCGACATTCTGGAAGATCTTCTGAAGGCAGAAGGGTTGACCTCCCAGGAC
TATTCCTTCGGAATGAGCGAATCCTACCGGAGCCGCTCATTCGTCTGCCGCTTCGAGGAATCCGCCCTCT
CCTTCGTCGACCGCTGGGCCGAACGGGAAGGCATCGCCTATTACTTCGACCACGATGACCATAAAGACCG
GCTCGTCTTTTTTGACCACCCTTCCCGAAAACCCTCATGGAAAAAATCGCTCTCCTACAGGCCACCATCC
GAACTCGACCCGGGCTTTTCCGACGATTCTCTCCAGGAATGGTCCCTGCGGATCGTCCCGTTGCCCCACC
GGATCGTCGTTTCGGACTTCAACTACCGGAAAGCCAATCTCGAGATCGAAGAAAGCCGGATTCTCGACCC
ACGGGGGAAGGGAACCGTCCGCGCGTTCGGAGAGAATACCCGGACAAACGCGGAAGCCCAGAGACAGGCG
ACGATCCTTTCGGAAATCCATAAGGTCCGCGAAAAGACCTGTGAAGGAAAAACCACCGCGACAGGAATCC
GCGCCGCCACGACCGTCCATATAAAACATCATTTCCGGAACGACCATAACGGAACATTTTTTGTCACCTC
AGTCCTTCACAAGGGATCCCAGGCCGCATTTCTGACCTCCGGATTCGATGTCCGGTCTCCAAAAGAACAG
AGACAGACACACTACGAGGCCACATTCGTCGCAATCCCTTCCGATGTGGCCTTCCGGCCCCAGAGAACCA
CTCCATGGCCGAGGATTCCCGGAGTCTCAAGCGCCATCATCGAGGCCGAGGGGTCAGGCCTCTTTGCCGA
ACTCTCCGAATATGGAGAGTACAAGGTCCGATTTCCGTTCATCTTCGGACAAAAGCGATCCCAGAAAAAC
TCGGGATGGATCCGGATGGCCACACCGCTGGCGGGCGCCGACAACGGGATGCACTTTCCCCTCCACAAGG
AGACCGAAGTCATGGTGGCCTTTCTGGGAGGAGACCCGGACCAGCCGGTGATTCTCGGAGCCGTCCACAA
CTCGGAGCACAGGGCCCTGATCACGAACAAAAATCCGGGGATCAACGTCATCCGGTCGATCGGAGGACAC
TCCATCACCCTGAACGACGACGGGTACGCATGA
 Primer design