SecReT6
Protein ID: 383785518
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2286
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2351222..2351905 [+]
Producthypothetical protein
NoteTssJ
UniProt IDI0IRQ9
KEGG IDlfc:LFE_2286
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.30E-13, Aligned region: 27..160
Protein Sequence: 227 a.a.     [Download]
>gi|383785518|ref|YP_005470088.1| hypothetical protein LFE_2286 [Leptospirillum ferrooxidans C2-3]
MAQGKKVQSHRYHKVIPVALWLPFIVLILSGCTTIGINTAPDAKIRQKVHWTWEKQAITIHVIPDRNLNL
SDKKPHTLIIGIAEISDPNGFLPLLQNPDRAMETLASGKKRSGILAVRRFIISPGTAGDIVLDRMRDAVY
LGIIAGYSGYSSKKDIRIRPMAVRVRRSGIIFRSNHFRPARMAVRLILGPKHLESLQVLDTTRKKKHKKK
QPDHPAPAKTPSAIRPL
 
Nucleotide Sequence: 684 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2351222-2351905 Leptospirillum ferrooxidans C2-3, complete genome
ATGGCTCAAGGCAAAAAGGTTCAGTCTCATCGATATCACAAGGTGATCCCGGTGGCTTTATGGCTCCCGT
TCATCGTTCTCATCCTTTCCGGATGCACAACGATCGGAATCAATACCGCCCCGGACGCCAAGATCCGACA
GAAGGTCCATTGGACATGGGAAAAACAGGCCATCACCATCCATGTGATTCCGGACAGGAATCTGAACCTT
TCCGACAAGAAGCCTCACACTCTGATCATCGGGATCGCCGAAATCAGCGATCCGAACGGCTTTCTTCCGC
TTTTGCAGAACCCGGACAGGGCCATGGAAACCCTTGCCAGCGGCAAGAAGCGATCCGGAATCCTGGCCGT
CAGGCGATTTATCATTTCTCCCGGCACCGCTGGTGACATCGTCCTCGACCGGATGCGGGATGCCGTCTAC
CTGGGAATCATCGCCGGCTATTCCGGCTACTCCTCCAAAAAGGATATCCGCATCCGGCCGATGGCTGTCC
GTGTCAGACGCTCCGGAATCATTTTCCGGAGCAACCATTTTCGTCCAGCCAGAATGGCTGTCCGGCTGAT
TCTTGGGCCAAAACATCTTGAAAGCCTTCAGGTCCTTGATACCACCAGGAAGAAGAAACACAAGAAGAAA
CAACCGGACCATCCCGCTCCGGCCAAAACACCTTCGGCCATCAGGCCCCTTTAG
 Primer design