SecReT6
Protein ID: 383785519
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2287
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2351922..2353301 [+]
Producthypothetical protein
NoteTssK
UniProt IDI0IRR0
KEGG IDlfc:LFE_2287
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.70E-93, Aligned region: 19..459
Protein Sequence: 459 a.a.     [Download]
>gi|383785519|ref|YP_005470089.1| hypothetical protein LFE_2287 [Leptospirillum ferrooxidans C2-3]
MKSTKPIFWHQGLFLQPQHFQLTDAHTTGMTRPVLDTVLPFGWGVQTIDIQTTALGRGSVQVNSLSMVLQ
DGSFVQFPGNAVIRPRSFEKDWTYRDKPLTIYAGLRRFRDQGKNVTTVPNLDSDADTRFLSLADPEEVQD
LYGEGPPASVKTLYFNVRLFWDNEIDNLEHYNLVPVAQVLWEGGVIKPSPSFIPPSLSLSTSRNLSSLVQ
EIRNECASRSRQLEEFKTPREQKTEGMDAGYMIYILALRTLNRYVPLLYHYAESDPVHPWLLYGTLRQMV
GEVSTFSDRVNFLGETDQSGEPLPPYDHEDIWGCLTKAQTVLFTLLNNLTVGPDLIIRLEKSDESFNGTL
SQSFFSPRTRYYLVVKTEGDPERESSSFMDNAKIGPPSIISSLIRRALPGVELTAMSGPPQGLPRRLNAQ
YFRIEPHDPVWDAIRQEEAIQVHWPGAPEGSMIDLIGVR
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2351922-2353301 Leptospirillum ferrooxidans C2-3, complete genome
ATGAAATCCACAAAACCGATCTTCTGGCACCAAGGACTTTTCCTTCAGCCCCAGCACTTCCAACTGACCG
ACGCCCATACCACCGGAATGACCCGCCCGGTCCTCGACACCGTTCTGCCCTTTGGATGGGGAGTCCAGAC
GATCGACATCCAGACGACCGCCCTCGGACGGGGATCGGTTCAGGTCAACTCCCTGTCCATGGTCCTTCAG
GACGGAAGCTTCGTACAGTTTCCCGGAAACGCAGTCATCCGACCCCGTTCTTTCGAAAAAGACTGGACAT
ACAGGGACAAGCCGCTGACGATCTATGCGGGTCTCCGGCGCTTCAGGGACCAGGGCAAGAATGTCACCAC
CGTCCCGAATCTCGATTCTGATGCAGACACCCGGTTTCTCTCCCTTGCCGACCCCGAAGAGGTCCAGGAC
CTTTACGGGGAAGGACCACCAGCCTCCGTCAAAACACTTTATTTCAATGTCCGTCTCTTCTGGGACAACG
AAATCGACAATCTCGAGCACTATAACCTTGTTCCCGTGGCGCAGGTCCTGTGGGAGGGAGGGGTCATCAA
GCCAAGCCCTTCTTTCATCCCTCCCTCCCTCTCCCTGTCCACCTCCCGGAACCTTTCAAGCCTTGTCCAG
GAAATCCGGAATGAATGCGCCAGCCGTTCCCGGCAGCTCGAGGAGTTCAAGACCCCCAGGGAGCAGAAGA
CGGAAGGAATGGACGCAGGATACATGATCTATATCCTCGCCCTCCGCACCCTGAACCGTTACGTCCCCCT
CCTCTATCACTACGCCGAAAGCGACCCTGTTCATCCATGGCTCCTCTACGGAACACTCAGGCAGATGGTG
GGAGAGGTCAGCACATTTTCCGACCGGGTCAATTTTCTCGGCGAGACCGATCAATCCGGAGAGCCCCTTC
CTCCCTATGATCACGAGGATATCTGGGGATGTCTGACCAAAGCCCAGACGGTGCTGTTTACATTGCTGAA
CAACCTGACCGTCGGACCGGATCTGATCATCCGGCTCGAAAAAAGCGACGAATCCTTCAATGGAACCCTT
TCCCAGTCCTTCTTCTCTCCCCGGACACGCTATTACCTGGTGGTCAAGACCGAGGGAGATCCGGAACGGG
AAAGCTCCTCCTTCATGGACAATGCGAAAATCGGCCCTCCCTCCATCATCTCCTCCCTGATCAGAAGAGC
TCTGCCCGGTGTCGAACTCACCGCCATGAGCGGACCGCCCCAGGGTCTTCCCAGAAGACTCAACGCCCAG
TATTTCCGGATCGAACCGCATGACCCGGTCTGGGACGCCATCCGTCAGGAGGAGGCGATACAGGTCCATT
GGCCGGGAGCACCTGAAGGTTCAATGATCGATCTTATTGGAGTCCGATAA
 Primer design