SecReT6
Protein ID: 383785520
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2288
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2353301..2353969 [+]
Producthypothetical protein
NoteTssL
UniProt IDI0IRR1
KEGG IDlfc:LFE_2288
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.90E-31, Aligned region: 3..206
Protein Sequence: 222 a.a.     [Download]
>gi|383785520|ref|YP_005470090.1| hypothetical protein LFE_2288 [Leptospirillum ferrooxidans C2-3]
MTTLSDCLIPLLAFVKDRLERSLPETNTLRREILDRIEKARSQAKSSGISDTHFESGLFPAIVWIDESLM
CANWPGAVDWSRNMLQKSFFRITNGGVEFYRRMPQETKDPNAREILSIYLMALKLGFRGQYGLESNGHEA
ARIQKHLQSILEPDLPIFERDKIFPSGYLTREGPEGQTKVASRKTLNTVFVWLVPSLMVLVLFVLYDRII
HQMTRNVLRHLH
 
Nucleotide Sequence: 669 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2353301-2353969 Leptospirillum ferrooxidans C2-3, complete genome
ATGACAACACTATCCGATTGCCTCATCCCCCTTCTGGCCTTCGTCAAGGACAGGCTCGAGCGTTCACTTC
CGGAGACAAACACCCTCAGGCGGGAGATCCTTGACCGGATCGAGAAGGCCCGCTCGCAGGCCAAAAGCTC
CGGCATCTCCGATACGCATTTTGAAAGCGGACTCTTTCCGGCGATCGTCTGGATCGATGAAAGCCTGATG
TGCGCCAACTGGCCGGGCGCGGTCGACTGGAGCAGGAACATGCTCCAGAAATCCTTTTTCAGGATCACGA
ACGGAGGGGTCGAGTTCTACAGGCGTATGCCCCAGGAGACAAAGGACCCGAATGCCAGGGAGATCCTGTC
GATCTACCTGATGGCCCTCAAGCTGGGATTCAGGGGGCAATACGGACTGGAATCGAACGGCCACGAGGCA
GCGAGGATCCAAAAACATCTCCAGAGCATTCTGGAACCGGATCTGCCGATCTTCGAAAGGGACAAGATCT
TTCCCTCCGGCTATCTGACCCGTGAGGGTCCGGAGGGCCAGACAAAGGTCGCCTCCCGGAAGACCCTGAA
CACGGTTTTCGTCTGGCTCGTCCCGTCCCTGATGGTCCTGGTCCTCTTCGTCCTGTACGACCGGATCATT
CACCAGATGACCCGAAACGTCCTCAGACACCTTCATTGA
 Primer design