SecReT6
Protein ID: 383785521
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2289
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2353986..2357828 [+]
Producthypothetical protein
NoteTssM
UniProt IDI0IRR2
KEGG IDlfc:LFE_2289
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.30E-43, Aligned region: 173..358
DUF1215 [PF06744], Evalue: 1.60E-05, Aligned region: 968..1027
Protein Sequence: 1280 a.a.     [Download]
>gi|383785521|ref|YP_005470091.1| hypothetical protein LFE_2289 [Leptospirillum ferrooxidans C2-3]
MIKKVLKPVLSLLLATALFILVWLFGSYEHWPIWLSLLSGAIVVLVSFSGRRIVGFIQKTASQQKLRASA
NLDKKSERLLSIGSLWKKAISTARGSAGRKSGNPISTLPLFLVLGGGTTGKTTLLANANVPIRFRNVSPQ
IDPPPTETIEFFFEDKAILLDTSGRYVNPEQTADINEEWDLITRLLLKTRQRESLSGVIVTISVEDLWSS
DSTKLARISQNIRQRIDSLMRTTNIRFPVYIMVTKLDLLSGFGHFVSSLPKPRTDEILGYLSKPEEQWDQ
TLESSLDRLSGEIREILFSRSDAGTDSSEALVFPLEIQALKPLLTPFIKGLFEASPYLELPVFRGVFLSS
GTIRGARFSSILGDEGGIRKEQPVEILEPNSRVALKSDQSTLELGNGNQAGARPASMISGGSPKKAPPFT
MGVFLKDFFTDLLPSDRSQVIPLGLLARWRRFSSNILLVSWYGFNLLLGLYFSYSFYVTYHTVKTLSARE
PGEIRIGGDFHQNLENLEGYRSLIDWMAGKDRSILFHLLAFSGQVGVIEDRMKERFTDLFSRAVLPEMNA
TLRAKIRELLNDDPKNQLADYAEILVRRINLIRDRENRMGYDDLKRQPQPGTLDLATIDPTISPQEARHF
ADLYLAYTAWVPAEAIGPSKDLLQSLLLEVEQTVPDFTWLVDWVNTQNLQNVTLATFWKGTATPKHGRTI
PAAYTNTGMRRIFEFLTEVQAASPPNFPIALHEQSFLAWYRIRKEEAWLGFLQSFQDGESTLSDAIAWKG
FFQSLPTPQNPYILLANRMSEEFPASQDNQHERWQDLLRRILRIENARPQSGLVSRIRGYAGILDASGST
GTHHGAKRGQRYFVSMIDASKAYTRFSQDLSQAVGDGLKGQGHALGLTAAYFSFSHRSKNKKPVLIDLGD
ALSSMKENLISSSDPKEILVWELVSGQFSSALDFLDREAACEINDRWVADVVSPAQASLTSKELNHFLLG
AGGSIPAFMEKTMKPFVMRGANGYRLITKDGAGVAVSPEFLVFINTAISGRRSLELAMKETELESKKQHL
DLVTLRQSLQKQDQDDSRKILMMTKKQFPVVLKALPTDVNSQSLSKPYLTRLTLSCAEKTHVLNNFNLPV
RSSWTWSPLVCGRTTLDIRIGKLTVSRSYPGPNGFAHFLEAFYQGRLRLTPQDFPLYKDALVNLHVTHLD
VRFRFKGAHALLSSYKQGQLAQASQDRIRNKIRKIDSELSILDQNDLEHQQESLKDRPFASDKIPVRISN
CFPGEQNASSQPEAPSHDNL
 
Nucleotide Sequence: 3843 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2353986-2357828 Leptospirillum ferrooxidans C2-3, complete genome
ATGATTAAAAAAGTCCTGAAACCGGTTCTCTCCCTTCTCCTGGCAACGGCCCTGTTTATCCTGGTGTGGC
TTTTTGGCTCCTATGAACACTGGCCCATATGGCTTTCCCTTTTATCCGGCGCCATCGTAGTGCTTGTCTC
CTTCTCCGGACGCCGGATCGTCGGGTTCATCCAAAAAACGGCCTCCCAGCAAAAGCTCCGTGCTTCCGCC
AATCTGGACAAGAAATCAGAGCGGCTTCTTTCGATCGGAAGCCTCTGGAAAAAAGCCATCTCCACCGCCC
GGGGATCGGCCGGGAGAAAGAGCGGGAACCCGATCTCCACCCTGCCGCTGTTCCTTGTTCTGGGCGGGGG
TACAACAGGAAAGACCACCCTTCTGGCCAATGCGAACGTCCCGATCCGCTTCAGGAACGTCTCTCCCCAA
ATCGATCCGCCCCCCACCGAAACCATCGAGTTTTTCTTCGAGGACAAGGCGATCCTTCTGGACACTTCGG
GACGTTACGTCAATCCCGAGCAGACCGCCGACATCAATGAGGAATGGGATCTGATCACAAGACTTCTTTT
AAAAACGCGCCAGAGAGAATCCCTGAGCGGCGTGATCGTGACCATTTCCGTCGAAGATCTCTGGAGCTCC
GACAGCACAAAGCTTGCCCGGATCTCCCAGAACATCCGGCAGAGGATCGACTCCCTGATGCGGACCACCA
ACATCCGCTTTCCCGTATACATCATGGTCACCAAGCTCGATCTTCTGTCGGGATTTGGCCATTTTGTCTC
GTCGCTCCCGAAGCCCCGGACCGATGAAATCCTGGGATATCTTTCAAAACCGGAAGAGCAGTGGGACCAG
ACGCTTGAGTCCTCCCTCGACAGGCTGTCCGGAGAGATCCGCGAGATCCTCTTTTCCAGGAGCGATGCCG
GAACAGACTCCTCCGAGGCTCTCGTGTTCCCGCTCGAAATCCAGGCCCTCAAGCCCCTTCTCACCCCCTT
TATCAAGGGACTGTTCGAAGCCTCACCCTATCTCGAGCTTCCGGTCTTCCGGGGGGTTTTCCTTTCAAGC
GGAACGATCCGCGGAGCCCGGTTCTCCTCGATTCTTGGCGATGAAGGCGGAATACGAAAAGAACAACCCG
TTGAAATTCTCGAGCCCAACTCCCGGGTTGCCCTCAAATCCGACCAGAGCACCCTGGAGCTGGGGAACGG
AAACCAGGCCGGCGCCCGACCGGCCTCGATGATCTCCGGAGGTTCTCCCAAAAAAGCACCACCCTTCACC
ATGGGCGTTTTCCTCAAGGATTTCTTTACGGACCTTCTGCCCTCCGACCGCTCCCAGGTCATTCCACTGG
GTCTTTTGGCCCGATGGAGACGCTTTTCCTCGAATATCCTCCTTGTGAGCTGGTACGGATTCAATCTTCT
TCTGGGACTTTATTTTTCCTATTCGTTTTACGTGACCTACCATACCGTCAAAACGCTTTCCGCCCGGGAG
CCCGGAGAAATCCGGATCGGAGGAGATTTTCACCAGAATCTGGAAAACCTCGAGGGTTACCGGAGCCTGA
TCGACTGGATGGCGGGAAAGGATCGATCGATCCTCTTTCACCTTCTCGCTTTTTCCGGACAGGTGGGGGT
GATTGAAGACCGGATGAAGGAGCGATTCACCGACCTGTTTTCAAGGGCGGTCCTTCCCGAGATGAATGCG
ACGCTCCGGGCCAAAATCCGGGAGCTTTTAAACGATGATCCCAAAAATCAGCTGGCCGACTATGCCGAAA
TCCTGGTCCGGAGAATCAATCTCATCAGGGACCGGGAAAACCGGATGGGATACGACGATCTGAAGCGGCA
ACCCCAGCCGGGAACACTGGACCTCGCCACCATCGATCCGACCATCTCTCCCCAGGAAGCCCGGCACTTC
GCCGATCTCTATCTGGCCTACACCGCATGGGTTCCGGCCGAAGCCATCGGCCCCAGCAAGGACCTTCTCC
AGTCCCTCCTTCTGGAGGTCGAACAGACCGTTCCCGACTTCACATGGCTTGTCGACTGGGTCAACACCCA
GAACTTGCAAAATGTCACTCTGGCAACCTTCTGGAAGGGAACCGCCACCCCCAAACATGGCCGGACCATT
CCGGCTGCCTACACAAACACCGGCATGAGACGGATCTTCGAATTTCTCACCGAGGTCCAGGCGGCAAGTC
CGCCAAACTTCCCCATCGCCTTGCATGAACAATCCTTCCTGGCCTGGTACAGGATCCGAAAGGAAGAGGC
ATGGCTCGGTTTTCTCCAGTCCTTCCAGGACGGCGAGTCGACCCTCTCCGACGCCATTGCCTGGAAGGGT
TTCTTCCAGAGCCTTCCGACACCCCAAAATCCCTACATCCTCCTTGCAAACCGGATGTCGGAGGAATTTC
CGGCGAGCCAGGACAACCAGCACGAACGCTGGCAGGATCTTCTCCGAAGGATCCTCAGGATTGAAAACGC
CAGACCCCAGTCGGGTCTGGTCTCCCGTATCCGGGGATACGCCGGCATCCTCGACGCGTCCGGCTCCACC
GGAACCCATCATGGGGCCAAACGGGGACAGAGATACTTCGTTTCCATGATCGATGCGAGCAAGGCCTATA
CCCGGTTTTCCCAGGATCTCTCCCAGGCGGTGGGAGACGGGCTAAAGGGACAGGGACACGCCCTGGGTCT
GACCGCGGCCTATTTCTCCTTCAGCCATCGTTCCAAAAATAAAAAACCCGTCCTGATCGATCTCGGAGAT
GCCCTCTCCAGCATGAAAGAGAACCTGATCTCGAGCTCGGATCCCAAGGAAATTCTCGTCTGGGAGCTGG
TGTCCGGCCAGTTTTCAAGCGCCCTTGATTTTCTCGACCGGGAAGCGGCCTGCGAGATCAACGATCGCTG
GGTCGCCGATGTCGTCTCTCCCGCCCAGGCCTCTCTCACGTCGAAAGAGCTCAATCATTTTCTTCTGGGA
GCGGGAGGAAGCATCCCCGCCTTCATGGAGAAAACCATGAAACCCTTTGTCATGCGGGGCGCAAACGGCT
ACAGGCTCATCACGAAAGACGGAGCCGGAGTCGCCGTATCACCAGAATTTCTGGTCTTCATCAACACGGC
CATCTCGGGACGGCGATCGCTGGAACTGGCGATGAAAGAGACCGAACTCGAAAGCAAGAAACAGCATCTC
GATCTCGTCACCCTGAGGCAGTCCCTTCAGAAACAAGATCAGGACGACTCCAGAAAGATCCTCATGATGA
CCAAAAAACAGTTCCCGGTGGTGTTAAAGGCCCTTCCGACGGACGTGAACAGCCAGAGTCTTTCGAAGCC
CTACCTGACACGTCTGACACTTTCCTGCGCGGAAAAGACGCATGTGCTCAACAATTTCAACCTTCCGGTC
CGGAGCTCCTGGACATGGTCCCCCCTTGTCTGCGGAAGGACGACCCTCGATATCCGCATCGGAAAACTCA
CCGTGAGCCGGAGCTATCCGGGACCCAACGGTTTCGCCCATTTTCTGGAAGCCTTCTATCAGGGCCGATT
GAGGCTGACACCCCAGGACTTCCCTCTCTACAAGGACGCCCTCGTCAACCTCCATGTGACCCACCTTGAT
GTCCGTTTCCGGTTCAAGGGAGCGCATGCTCTCCTGTCCAGCTACAAGCAGGGCCAGCTGGCCCAGGCCT
CCCAGGACAGGATCCGGAACAAGATCAGGAAAATCGACTCGGAGCTCTCGATTCTCGACCAGAATGACCT
CGAGCACCAGCAGGAATCTTTAAAAGACAGGCCCTTCGCCAGCGACAAGATCCCCGTGAGAATCTCAAAC
TGCTTCCCGGGAGAACAAAACGCGTCATCACAACCGGAGGCGCCATCTCATGACAACCTGTAG
 Primer design