SecReT6
Protein ID: 383785522
SecReT6 ID567
T6SS typei1
Gene symbol-
Locus tagLFE_2290
StrainLeptospirillum ferrooxidans C2-3
Repliconchromosome [GenBank: NC_017094] [Browse all T6SS(s) in this replicon]
Location [Strand]2357874..2359418 [+]
ProductImpA domain protein
NoteTssA
UniProt IDI0IRR3
KEGG IDlfc:LFE_2290
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.40E-22, Aligned region: 50..110
Protein Sequence: 514 a.a.     [Download]
>gi|383785522|ref|YP_005470092.1| ImpA domain protein [Leptospirillum ferrooxidans C2-3]
MNLESIRELGKKAIPGEFPAGRDVRELEGFLALQAEIDRSQSISASGAVDWKKVQKLSEELLDREGKDLL
VACYLSVALTRTGGPPGFLAGLKVMADLVEDYWETLFPPLKRLRGRRNAISWWLEQQKEILPKLDNPPLS
PREMADGREVARRLNRTLGDKDPEGPLLSPVIALLDALPVLEPEPLQEIKEAVPPESSAPSPEPLEPVSR
QEEPIAIPEEEPEDTLERIYVAMKIVSENLLAGDPTDFRIYRTSRMSLWDPISVLPDSQDRVTRIPPPPH
PLQSALESVLASGSPEDLIAFSETQQPVYPFWLDLSFHEAMALEKMGESGQQAALALKGEISFLLKRLSG
IESLSFSDNTPFLSPEGKKWLESLHMGDQPPGGGETLASSALFEPVRLMIGDGRHEEAARRFEEIRKKAP
SARIRLHLDTEFLMEIAGRGRDFPVEIFALSLLRESDRIDLDLWEPELSKRVLPLLYRIFSQSEEDELQK
EAGHLMRRLVALDISSAIVTFQKR
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|383783295|ref|NC_017094.1|:2357874-2359418 Leptospirillum ferrooxidans C2-3, complete genome
ATGAACCTTGAATCGATCAGAGAACTTGGCAAAAAGGCGATCCCCGGAGAGTTCCCTGCCGGTCGCGATG
TTCGGGAGCTTGAGGGCTTTCTGGCTCTTCAGGCGGAAATCGACCGAAGCCAGTCCATCTCCGCGTCAGG
AGCGGTCGACTGGAAAAAGGTCCAGAAACTCTCCGAAGAGCTTCTCGACAGGGAGGGAAAAGACCTTCTG
GTCGCCTGCTACCTTTCCGTCGCCCTGACCCGAACCGGGGGTCCCCCCGGTTTTCTGGCCGGCCTCAAGG
TCATGGCCGACCTCGTCGAAGACTATTGGGAAACCCTTTTTCCACCCCTGAAAAGACTGCGGGGAAGACG
GAACGCCATTTCCTGGTGGCTCGAACAGCAAAAGGAAATCCTTCCGAAGCTGGACAATCCTCCACTGTCT
CCCCGGGAGATGGCCGATGGCCGGGAGGTCGCCCGTCGATTGAACCGGACATTGGGAGACAAAGACCCTG
AAGGCCCCCTTCTGAGCCCTGTCATTGCCCTTTTGGACGCCCTTCCCGTCCTGGAGCCAGAGCCTCTCCA
GGAGATAAAGGAGGCTGTCCCCCCCGAGAGTTCAGCTCCCTCTCCGGAACCTTTGGAACCCGTGTCCCGT
CAGGAGGAGCCGATCGCTATCCCGGAGGAAGAACCGGAAGACACTCTGGAGCGGATCTATGTGGCCATGA
AAATCGTTTCGGAAAATCTTCTGGCCGGGGATCCCACCGATTTCCGGATTTATCGTACTTCCAGAATGTC
CCTGTGGGACCCGATCTCCGTTCTCCCCGACTCCCAGGATCGGGTCACCCGCATTCCCCCTCCTCCCCAT
CCCCTTCAGTCCGCACTGGAATCCGTTCTCGCCTCGGGCAGTCCCGAAGACCTGATCGCCTTTTCGGAAA
CCCAGCAACCGGTTTACCCCTTCTGGCTGGATCTGTCCTTCCACGAGGCCATGGCGCTTGAAAAGATGGG
CGAATCCGGCCAACAGGCCGCTCTTGCCCTCAAGGGAGAGATCTCCTTCCTGTTAAAACGGCTTTCCGGA
ATCGAATCACTCTCTTTCTCGGACAACACTCCCTTCCTTTCTCCCGAAGGCAAAAAATGGCTTGAATCTC
TCCACATGGGCGATCAGCCCCCCGGAGGGGGGGAGACGTTGGCTTCATCAGCGCTTTTCGAGCCGGTGCG
GCTGATGATTGGCGATGGACGACATGAAGAAGCGGCCAGACGATTTGAGGAGATCCGGAAAAAGGCACCT
TCGGCCCGGATCCGGCTTCACCTGGATACGGAGTTTTTGATGGAGATCGCCGGAAGGGGTCGCGATTTCC
CCGTTGAAATATTTGCGCTTTCCCTCCTCCGGGAGAGCGACCGGATCGATCTCGACCTTTGGGAACCGGA
GCTCTCCAAAAGGGTTCTCCCGCTCCTCTACCGGATCTTTTCGCAAAGTGAAGAGGACGAGCTCCAGAAG
GAAGCCGGCCACCTGATGCGCCGTCTAGTCGCTCTGGACATCTCCAGTGCCATCGTAACATTCCAGAAGA
GATGA
 Primer design