SecReT6
Protein ID: 384123153
SecReT6 ID571
T6SS typei3
Gene symbol-
Locus tagYPD4_2563
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3264958..3267543 [-]
Producthypothetical protein
NoteTssI
UniProt IDD0JEX6
KEGG IDypd:YPD4_2563
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.70E-76, Aligned region: 18..336
Phage_base_V [PF04717], Evalue: 3.70E-24, Aligned region: 376..469
Protein Sequence: 861 a.a.     [Download]
>gi|384123153|ref|YP_005505773.1| hypothetical protein YPD4_2563 [Yersinia pestis D106004]
MPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDLKSLIGKEMTIEMELDGNGLGD
VRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDIIEEVFSDYNFPF
EKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGAHKRSFSTAYHAIEYL
SDEPKAGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHWPGDYDQPDIGE
HLSRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVDQLSGGEDAFSC
ESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGTNSESDSCWLRV
SQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLPANATQSGMVSRTVGGGLTN
YNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADSVLNVGANRSEVVGANYNQDVLGTSMLAIGAA
SMLQVGLARSVVVGGAHSLNVVLANATNVGGANMTNVGGFNGLAVGGAHQTAVGGAATLAAGGPIAIGAG
GELILSGDIVKIVGKSKVIIQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGAIALPLPLPLLP
IVVPPVTSPPDPTVPPDPTLPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPETTAPPETTAPPETTAPP
ETRHRRKHGTAGNTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAP
PEPTRTPPGRRRHRLDFIDKR
 
Nucleotide Sequence: 2586 bp     [Download]
>gi|384120592|ref|NC_017154.1|:c3267543-3264958 Yersinia pestis D106004 chromosome, complete genome
ATGCCTTATCTATTGGGTGAGCCTGCGCTGGTACTGTCTAAGTTGGAAGGCGAGGAAGCCTTTTCGACTT
TATATTCTTATACTATTACGGCAAAGACACCGGCTAACCCATTAATTCCTTGGCAAGCGGCTTCAAATGT
CGATCTCAAATCCTTAATTGGTAAAGAGATGACGATTGAAATGGAACTGGACGGCAACGGCCTGGGTGAT
GTGAGAAGTGTAGGTAAAGGCACGCGTGAAATTACGGGGCTGGTTGAGAGAGCCAGATACATTGGTCGAG
ATGCCAATCAGGCCATATTTGAGATCACTATTAAGCCTTGGTTCTACCTGGCTAATTTAACCTCTGACTT
TAAAATTTATCAAAATAAAAATGTCGTTGATATTATAGAGGAAGTGTTCTCAGACTATAATTTTCCGTTT
GAGAAACGGTTGGCTACAACCTATCCGATATTAGATTTTCAGGTTCAGTACGGTGAAACCGACTTTAATT
TCCTTCAGCGTTTGATGGAAGAGTGGGGTATTTACTGGTTCTTTGAGCATCAGGATCATAAACAAAAATT
AATTCTTGTGGATCATGTCGGTGCGCATAAACGCTCGTTCAGTACCGCCTACCATGCCATTGAGTACTTG
TCGGATGAGCCTAAAGCGGGCGAAGAGTACATCACACAATTCCAGACTCAGGAAACCTTGACGAGTGGGA
CCTGGGTCACCAACGATTATGACTTCACGAAATCCCGTGCCGATATTCTGGCAATGGACAGTAAACCGCG
TAAAACCAGCTTTAACGATCTCGAGATTTATCACTGGCCAGGGGATTATGATCAGCCAGATATTGGTGAG
CACCTTTCACGCGTGCGTATCGAAGAACGTGGTGCTCTGGGTTCGCGGGCGGTCGGTTCTGGTCAACTGC
GCGGGATAGTTTGTGGTGCTAACTTCGAGCTGAAAGGGTTCCCCGTTGATAAAGCGAATCGGGAATACAT
GATTATCTCCAGCCGTTTGACGGTGGCTGAAGTTGATCAACTGTCTGGCGGTGAGGATGCGTTTAGTTGC
GAGAGTTCTTTCACGGTTCAGCCGACGACCAAAATCTATCGTCACCCACAGGTGACACCAAAACCGAAAA
CCAATGGGCCGCAAAACGCCATTATTGTGGGGCCACCGGGTGAAGAGATTTGGACCGATGAATATGGCCG
CGTAAAAGTGCGTTTCGTTTGGGATCGCTATGGCACAAACAGCGAGTCAGACTCTTGCTGGCTACGTGTT
AGCCAGGCTTGGGCAGGGAACAGCTTTGGTGGGATCTATATTCCACGCATTGGTCAGGAAGTCATTGTTG
ACTGTATTAACGGCGATCCTGACCGGCCAATGGTGATGGGCAGCCTTTATAATAACGTGACGCGTCCCCC
TTGGGACCTGCCTGCCAATGCGACGCAAAGTGGCATGGTCAGTCGTACCGTTGGCGGCGGGTTAACCAAC
TATAACGGCGTTCGTTTTGAAGATAAATCGGGGCTGGAGCAGTACTGGGAACAGGCCGAGCGCGATATGT
CGCGTTTGACTAAAAATAATGAAACGCAAATTATCGGTGCCGATTCTGTCCTGAATGTAGGGGCCAACCG
AAGTGAAGTTGTCGGGGCCAATTATAACCAAGATGTTCTTGGCACATCAATGTTAGCCATCGGTGCAGCC
TCTATGCTACAGGTGGGATTGGCGCGTAGCGTTGTGGTTGGCGGAGCACATTCACTGAATGTGGTTTTGG
CGAATGCCACCAATGTGGGTGGCGCTAACATGACCAACGTAGGGGGGTTTAATGGCCTTGCGGTGGGGGG
AGCCCATCAGACAGCTGTAGGCGGTGCTGCGACACTGGCTGCCGGCGGCCCTATTGCTATTGGGGCGGGT
GGTGAGCTTATCCTCAGTGGGGATATCGTAAAAATTGTTGGTAAAAGTAAGGTTATTATTCAGGGCGGTG
AAGTTCACATTAACTCTGATGATTGTTGTGGTCGTAAAACGGGCAATGGCGGCGGGGCATTCGGTGCCTT
TGCGAGCCTGGCAGGTTTATTGCCGCTGGCGGGTGCTATTGCCTTACCGCTACCGTTACCCTTGTTGCCA
ATAGTGGTGCCACCAGTGACATCGCCACCGGATCCAACAGTGCCACCGGATCCGACATTGCCACCGGATC
CGACATTGCCACCAGATCCAACGTTGCCACCAGATCCAACGTTACCGCCGGAAACCACGGCACCGCCGGA
AACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGCCAGAGACAACGGCACCGCCG
GAAACACGGCACCGCCGGAAACACGGCACCGCCGGAAACACGGCACCGCCAGAAACAACGGCACCGCCAG
AAACAACGGCACCGCCGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCAGAGACAACGGCACCGCC
AGAAACAACGGCACCGCCAGAAACAACGGCACCGCCAGAAACAACGGCACCGCCAGAAACAACGGCACCG
CCGGAACCGACGCGAACACCGCCAGGACGCAGACGCCACCGCCTTGATTTTATAGATAAAAGGTAA
 Primer design