SecReT6
Protein ID: 384123155
SecReT6 ID571
T6SS typei3
Gene symbol-
Locus tagYPD4_2565
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3271706..3272266 [-]
Productputative OmpA family protein
NoteTagL
UniProt IDD0JEX8, D0JEX8
KEGG IDypd:YPD4_2565
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 6.60E-17, Aligned region: 80..178
Protein Sequence: 186 a.a.     [Download]
>gi|384123155|ref|YP_005505775.1| putative OmpA family protein [Yersinia pestis D106004]
MLLCGFLIVATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLRLSILLKDEIAKQLVSVDETSNN
SKVIFKGDSMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDSMPINKPGFPNNQVLSEKRAANV
ARYMEQAGIPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 561 bp     [Download]
>gi|384120592|ref|NC_017154.1|:c3272266-3271706 Yersinia pestis D106004 chromosome, complete genome
ATGCTGTTGTGTGGTTTCCTCATTGTCGCGACCTTTATTGGATGTAAATACTTTCTCTCGGTACCGGAAA
GTGACTTGCTAAAAAGAATGGGAGCATTGCAACGTGTGGTTGTGACGCCACCCGTTGCCGCACCAAAACT
TCGACTGTCTATTTTATTAAAAGATGAGATAGCGAAGCAGTTAGTCAGTGTTGATGAAACGAGCAACAAC
AGCAAAGTCATCTTTAAAGGCGACTCTATGTTTATGGTCGGCTCGGATAACGTCAGACCTGAAATGATTG
ACGTAATTAAACGCGTCGCGCAGGAAGTGCATCGCGTTAAAGGGGCAATCCTCATCGTCGGGCATACAGA
CTCTATGCCGATTAATAAACCCGGCTTCCCTAATAACCAGGTACTTTCCGAAAAACGCGCGGCCAATGTT
GCACGCTATATGGAGCAGGCCGGTATTCCAACCGACAAAATTCGGTTTGAGGGCAAGGGGGAAACGCAAC
CGGTTAGCAGCAATGACGATGCGACAGGACGTTCGCAAAACCGCCGCGTAGAAATTTTTGTTAATTATTG
A
 Primer design