SecReT6
Protein ID: 384123158
SecReT6 ID571
T6SS typei3
Gene symbol-
Locus tagYPD4_2568
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3274373..3274978 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDD0JEY1
KEGG IDypd:YPD4_2568
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-29, Aligned region: 65..177
Protein Sequence: 201 a.a.     [Download]
>gi|384123158|ref|YP_005505778.1| DotU family type IV / VI secretion system protein [Yersinia pestis D106004]
MDESPQALGRFLLDEPMTSPDSTQDNTAFTREAPHSGAAQQYDTTLLRGESVQQRVAKVLASSTPLLEAA
QPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMAIVRYCLCTALDEAAHTMSWGM
MAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYAVTNGAIVIHTQRLKSDPGGNLLS
 
Nucleotide Sequence: 606 bp     [Download]
>gi|384120592|ref|NC_017154.1|:c3274978-3274373 Yersinia pestis D106004 chromosome, complete genome
GTGGATGAGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATGAGCCAATGACATCCCCAGATAGCACTC
AGGATAATACGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGCGGCACAGCAATATGACACGACCCTCTT
ACGGGGTGAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCATCTTCAACGCCATTATTGGAAGCGGCA
CAGCCACTATTACGTGCCTTGAGCGAGATGCCCGCGCATATTGGGGATGTTTCACAGGTTCATATATTAA
AACAAAGCCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATATCTCATGGAAAAA
AATGGCTATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGAATG
ATGGCAGGTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTT
TCTTATTGGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCTGTAACGAACGGTGCAATAGTGATCCA
CACCCAACGCCTGAAATCAGATCCAGGGGGTAATCTGCTCTCCTGA
 Primer design