SecReT6
Protein ID: 384123160
SecReT6 ID571
T6SS typei3
Gene symbol-
Locus tagYPD4_2570
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3276391..3276930 [-]
Producttype VI secretion lipoprotein, family
NoteTssJ
UniProt IDD0JEY3
KEGG IDypd:YPD4_2570
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-36, Aligned region: 22..172
Protein Sequence: 179 a.a.     [Download]
>gi|384123160|ref|YP_005505780.1| type VI secretion lipoprotein, family [Yersinia pestis D106004]
MNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIALYTLKST
DEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAEWKAVIYP
LPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 540 bp     [Download]
>gi|384120592|ref|NC_017154.1|:c3276930-3276391 Yersinia pestis D106004 chromosome, complete genome
ATGAATAAAAGTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTTTGGTACTGGTAACGTTATTGA
CGATAGCCTGTAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAGCTTACCGTCGAAATCGCGACAGCAGC
GGATATTAATCCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCACTTTATACACTCAAGAGCACC
GATGAATTTCAGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGCCATCGCTAAAAGAACAAATGG
ATAACGTGTTTGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGAGCTGACACTTGATGCTGGCGT
TACTGCTATCGGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAGTGGAAAGCGGTTATTTATCCG
TTGCCCAAAAAACGCGTGGATCCTTGGTATAAAAAAATGTGGCCAGGGCAAGACCAACAAGATCCGATCA
TGAAGGTACGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTAA
 Primer design