SecReT6
Protein ID: 384123162
SecReT6 ID571
T6SS typei3
Gene symbol-
Locus tagYPD4_2572
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3278015..3279517 [-]
Producthypothetical protein
NoteTssC
UniProt IDD0JEY5
KEGG IDypd:YPD4_2572
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.90E-194, Aligned region: 68..494
Protein Sequence: 500 a.a.     [Download]
>gi|384123162|ref|YP_005505782.1| hypothetical protein YPD4_2572 [Yersinia pestis D106004]
MSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVSDDAYKSIASI
IAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRYKGVAWDQ
SPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQMESWQEL
SNPRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLSRLPYGINTNPVDAFHFEETTDGADHSKYVW
SNAAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNG
FIPLVHRKNTDYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERD
EMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRMV
AKLPSLKDVA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|384120592|ref|NC_017154.1|:c3279517-3278015 Yersinia pestis D106004 chromosome, complete genome
ATGTCCACTCAAGACGCAAAAACTAAACAAGCTACAGTCGCCAGTGCGACGGAATATAGCGATTTTAATA
CATTACTGACTAAAGAATTTAAAGCGAAGTCTGAGCAAACGATAGCCGCAGTAGAAGGTGCCGTTAAAAC
GTTGGCTGAGCAAGCGCTGGCTAATTCGGTCACGGTGTCAGACGATGCTTATAAAAGTATTGCTTCCATT
ATTGCAGAGATTGATCGCAAGCTATCAGATCAGATTAACTTAATTTTGCACCACCAAGAATTCCAGTCTC
TGGAAAGCGCATGGCGTGGGCTGCACTATTTAGTCAATAACACCGAGACTGATGAGAAGTTGAGATTACG
TTTCCTCGACATTTCTAAAGATGAATTACGCCGTAACATGAAGCGTTATAAAGGTGTTGCTTGGGATCAA
AGCCCATTATTCAAAAAAATCTATGAAGAAGAATATGGCCAATTGGGTGGCGAACCATACGGTTGCCTGG
TAGCAGACTATTACTTTGACCATACTGCACCTGACGTTGACTTGTTGGCTTCAATTGGCAAAGTTGCCGC
TTCTGCCCACGTGCCATTTATTACAGGTGCTGCACCGTCTGTGTTGCAAATGGAATCTTGGCAAGAACTG
TCAAACCCACGTGATTTGACGAAGATCTTCACTCAGAATCTTGAGTATGCCGCATGGAACTCACTGCGTC
AGTCTGAAGACTCTCGCTATATCGGCCTGGCGATGCCACGTTTCTTGTCGCGTCTGCCTTATGGGATTAA
CACCAATCCGGTAGATGCCTTCCACTTTGAAGAGACGACTGATGGCGCGGATCACAGCAAATATGTGTGG
TCAAATGCGGCTTATGCGATGGCTGTTAACATCAACCGATCTTTCAAAGAGTATGGCTGGTGTACGCTGA
TTCGTGGTGTGGAAAGTGGTGGTGTTGTTGAAGGCCTGCCATGCCATACCTTCCCGACGGATGACGGCGG
TATTGATATGAAATGCCCAACAGAAATCGCTATTTCTGACCGTCGTGAAGCGGAACTGGCCAAGAATGGC
TTTATTCCACTGGTTCACAGAAAGAATACGGATTACGCGGCATTCATTGGCGCGCAGTCCCTGCAAAAAC
CTGCAGAATATTACGATTCGGATGCAACGGCGAACGCCAACCTTTCCGCTCGTCTGCCATACCTGTTTGC
TTGTTCACGTTTTGCACATTATCTGAAGTGCATCGTGCGTGACAAAATCGGCTCTTTTAAAGAGCGTGAT
GAGATGCAACGTTGGTTGAATGATTGGGTGATGAACTATGTTGATGGTGACCCAGCTAACTCTTCCCTGG
AAACTAAAGCGCGCCGTCCTTTAGCCGCCGCTGAAGTGATTGTTGAAGAAGTTGAAGGTAACCCTGGTTA
CTATCAGGCTAAATTCTTCTTACGCCCTCATTTCCAGTTAGAAGGTTTGACAGTATCCCTGCGTATGGTT
GCTAAACTGCCTTCGCTGAAAGACGTAGCATAA
 Primer design