SecReT6
Protein ID: 384123163
SecReT6 ID571
T6SS typei3
Gene symbol-
Locus tagYPD4_2573
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3279541..3280011 [-]
Producthypothetical protein
NoteTssB
UniProt IDD0JEY6
KEGG IDypd:YPD4_2573
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-54, Aligned region: 2..146
Protein Sequence: 156 a.a.     [Download]
>gi|384123163|ref|YP_005505783.1| hypothetical protein YPD4_2573 [Yersinia pestis D106004]
MQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLLDIDIDNFDERMKAMKPRVAFAVLNT
LTGEGQLMVDITFESMDDFSPDAIAKKVDSLSQLLDARTQLANLQTYMDGKAGAEELVMKLLKDKSLLTT
LASAPKAKQSAVDTPQ
 
Nucleotide Sequence: 471 bp     [Download]
>gi|384120592|ref|NC_017154.1|:c3280011-3279541 Yersinia pestis D106004 chromosome, complete genome
GTGCAGATTGAATACGATGTGGAAATATACGGTAGTGAAAAGAAGGTTGAATTACCTTTCGTTATGGGGG
TATTAGCAGATTTATCCGGTAAACCTCTTGAGCCTTTACCTTCAGTCGCTGACAGAAAACTGTTAGATAT
CGATATTGATAATTTCGATGAGCGCATGAAAGCAATGAAACCACGTGTTGCATTCGCCGTGCTGAATACA
TTGACTGGGGAAGGCCAGTTAATGGTCGATATTACGTTTGAGAGTATGGATGATTTCTCTCCTGACGCTA
TCGCGAAAAAAGTTGATTCATTGTCTCAATTATTAGATGCCCGAACTCAACTTGCCAACTTGCAGACTTA
TATGGATGGTAAGGCTGGTGCTGAGGAATTAGTTATGAAATTGCTGAAAGACAAATCATTACTGACAACG
CTTGCATCCGCACCGAAAGCAAAACAATCCGCTGTTGATACTCCACAGTAA
 Primer design