SecReT6
Protein ID: 384123170
SecReT6 ID571
T6SS typei3
Gene symbolclpB
Locus tagYPD4_2580
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3286550..3289105 [-]
Productputative Clp ATPase
NoteTssH
UniProt IDD0JEZ3
KEGG IDypd:YPD4_2580
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.00E-39, Aligned region: 191..271
AAA_2 [PF07724], Evalue: 1.00E-39, Aligned region: 579..745
AAA [PF00004], Evalue: 3.50E-21, Aligned region: 193..324
AAA [PF00004], Evalue: 3.50E-21, Aligned region: 584..701
ClpB_D2-small [PF10431], Evalue: 1.70E-16, Aligned region: 751..829
AAA_5 [PF07728], Evalue: 3.10E-13, Aligned region: 193..271
AAA_5 [PF07728], Evalue: 3.10E-13, Aligned region: 583..701
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 171..211
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 231..271
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 427..460
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 458..524
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 581..619
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 648..671
AAA_16 [PF13191], Evalue: 1.60E-08, Aligned region: 747..771
Sigma54_activat [PF00158], Evalue: 1.90E-07, Aligned region: 188..272
Sigma54_activat [PF00158], Evalue: 1.90E-07, Aligned region: 583..682
AAA_22 [PF13401], Evalue: 4.60E-07, Aligned region: 193..277
AAA_22 [PF13401], Evalue: 4.60E-07, Aligned region: 326..359
AAA_22 [PF13401], Evalue: 4.60E-07, Aligned region: 581..603
AAA_22 [PF13401], Evalue: 4.60E-07, Aligned region: 645..670
AAA_14 [PF13173], Evalue: 3.30E-06, Aligned region: 193..274
AAA_14 [PF13173], Evalue: 3.30E-06, Aligned region: 582..665
AAA_25 [PF13481], Evalue: 4.70E-06, Aligned region: 193..217
AAA_25 [PF13481], Evalue: 4.70E-06, Aligned region: 581..608
AAA_19 [PF13245], Evalue: 1.60E-05, Aligned region: 191..216
AAA_19 [PF13245], Evalue: 1.60E-05, Aligned region: 581..605
IstB_IS21 [PF01695], Evalue: 3.50E-05, Aligned region: 187..212
IstB_IS21 [PF01695], Evalue: 3.50E-05, Aligned region: 583..603
Zeta_toxin [PF06414], Evalue: 4.90E-05, Aligned region: 193..213
Zeta_toxin [PF06414], Evalue: 4.90E-05, Aligned region: 576..623
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 183..213
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 581..608
NACHT [PF05729], Evalue: 9.10E-05, Aligned region: 193..224
NACHT [PF05729], Evalue: 9.10E-05, Aligned region: 583..610
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 172..206
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 246..343
Arch_ATPase [PF01637], Evalue: 0.00011, Aligned region: 582..628
AAA_17 [PF13207], Evalue: 0.00042, Aligned region: 194..212
AAA_17 [PF13207], Evalue: 0.00042, Aligned region: 338..366
AAA_17 [PF13207], Evalue: 0.00042, Aligned region: 583..618
AAA_18 [PF13238], Evalue: 0.0028, Aligned region: 193..212
AAA_18 [PF13238], Evalue: 0.0028, Aligned region: 585..609
AAA_23 [PF13476], Evalue: 0.0066, Aligned region: 193..213
AAA_23 [PF13476], Evalue: 0.0066, Aligned region: 429..502
AAA_23 [PF13476], Evalue: 0.0066, Aligned region: 581..606
UPF0079 [PF02367], Evalue: 0.0072, Aligned region: 193..213
UPF0079 [PF02367], Evalue: 0.0072, Aligned region: 581..610
Protein Sequence: 851 a.a.     [Download]
>gi|384123170|ref|YP_005505790.1| putative Clp ATPase [Yersinia pestis D106004]
MNQLWHQEDNDLKQIIRYFAVDVDAFERELAQALAKLPVGATSISDFSYHIELATERAWIYASLECLDTR
IRSGHLLLALLTTMELRRAFFAIAPSMEKIPLEHLSKDLNFITQASPEANEAASDGSPLYDGALPGEASN
AIGAAKSGGALAQYTTDLTALAREGKIDPVLGRNHEINTMVDILLRRRQNNPLLTGDAGVGKTAIVEGLA
LAIAAGSMPPALSQVSLLSLDIVALSAGASMKGEFEARLKSVLDEAIAAEKPVILFIDEVHTLIGAGGNA
GTGDAANLLKPALARGQLRTIGATTWSEFKRHIEKDPALTRRFQVLQVDEPDENTAISMLRGLIPALEKH
HGVWIMDEALQAAVRLSHRYIPARQLPDKAISLLDTACARIAVAQFSQPIELQHLTFQSETAQTELVSLE
KARHFGKAQDARTEQLKTSIAEHGEAADKLDQRWQAERELVSAITTIRTALYDLVSQPEPDEEKRRAYQA
QLVQLEAQLSQVRTSLPLVQTEVNAEVIASIVADWTGIPVGQMLKDDIRAVMELPQRLEARVIGQPHALM
QLGENIMTARAGLSDPRKPLGVFMLVGPSGVGKTETALAIAESMYGGEQNMITINMSEYQESHTVSSLKG
SPPGYVGYGEGGVLTEAVRRKPYSVVLLDEIEKAHSDVHELFFQVFDKGQMEDGEGRFIDFKNTILLLTS
NVGSELLSNLLADPDTAPDQDGILSALQPELLKVFPAAFLGRVTVIPYLPLQQDALQHIVRLHLDRIGAR
LYSQHQLTLKYSDEVVEDVVSRCAVSETGARMLIRYIEQNITPKIGKYILGDSDVKPEQIIFVHKNENGF
VIALQCKDDEN
 
Nucleotide Sequence: 2556 bp     [Download]
>gi|384120592|ref|NC_017154.1|:c3289105-3286550 Yersinia pestis D106004 chromosome, complete genome
TTGAATCAGCTTTGGCATCAGGAAGATAACGACCTTAAGCAGATTATTCGGTATTTTGCGGTGGATGTGG
ATGCCTTTGAGCGTGAACTGGCTCAGGCACTTGCGAAGTTACCTGTTGGGGCAACTAGCATTTCAGATTT
TTCGTATCATATTGAGTTGGCCACGGAACGGGCTTGGATCTATGCCAGCCTGGAGTGTTTAGATACCCGT
ATCCGCAGCGGACATCTGCTGCTTGCGCTATTAACCACAATGGAACTGCGGAGAGCTTTCTTTGCGATTG
CGCCAAGCATGGAAAAAATTCCATTAGAGCATTTAAGCAAAGATTTGAACTTCATTACGCAGGCATCACC
AGAAGCGAATGAAGCCGCCAGTGATGGCAGCCCGTTGTACGATGGTGCTTTACCTGGCGAAGCCAGTAAT
GCCATTGGTGCAGCCAAAAGTGGTGGCGCACTGGCTCAATACACCACAGACCTCACGGCATTAGCACGTG
AAGGCAAGATAGATCCGGTATTGGGACGTAATCACGAAATCAACACAATGGTTGATATTCTCTTGCGCCG
TCGGCAGAACAACCCATTACTTACCGGTGACGCAGGGGTGGGTAAAACCGCCATTGTTGAAGGGCTAGCA
TTGGCTATTGCTGCTGGCTCAATGCCACCAGCATTAAGCCAGGTAAGCCTGTTGTCATTAGATATTGTGG
CGCTCTCAGCGGGTGCCAGCATGAAAGGTGAATTTGAAGCGCGCCTGAAGAGTGTCTTGGATGAAGCGAT
AGCGGCAGAAAAGCCCGTTATTTTGTTTATCGATGAAGTACACACACTTATTGGCGCGGGTGGCAATGCC
GGGACCGGCGATGCGGCGAACTTATTGAAACCTGCATTGGCGCGTGGCCAGTTACGTACCATTGGTGCGA
CAACGTGGAGCGAGTTCAAGCGTCACATTGAGAAGGATCCGGCACTCACCCGTCGTTTCCAAGTACTTCA
AGTTGATGAGCCCGATGAGAACACGGCGATCTCCATGTTACGGGGCCTGATACCTGCGCTAGAAAAGCAC
CACGGCGTGTGGATTATGGACGAAGCTTTACAGGCGGCAGTACGGTTGTCTCATCGTTATATCCCTGCGC
GTCAGTTGCCGGATAAAGCGATAAGTCTGCTTGATACGGCTTGTGCACGGATCGCTGTCGCGCAGTTTTC
ACAACCAATAGAGCTACAGCACTTAACCTTCCAGAGTGAGACGGCGCAAACTGAGCTGGTTTCCTTAGAG
AAAGCGCGGCACTTTGGTAAAGCGCAGGATGCGCGTACTGAGCAGTTGAAAACATCCATTGCTGAACATG
GCGAGGCTGCGGATAAGCTTGATCAGCGTTGGCAGGCAGAACGCGAATTGGTATCAGCGATTACGACCAT
AAGAACCGCACTGTATGACTTGGTTTCTCAGCCAGAGCCTGATGAGGAAAAACGTCGGGCTTATCAAGCG
CAATTAGTTCAGTTGGAAGCGCAGCTTTCTCAGGTTCGCACTTCACTGCCGTTAGTGCAGACAGAAGTCA
ACGCTGAAGTGATTGCCAGTATCGTTGCGGATTGGACCGGCATTCCGGTTGGGCAAATGCTCAAAGACGA
TATTCGGGCGGTAATGGAGTTGCCACAGCGCCTTGAAGCACGTGTTATTGGTCAGCCCCATGCATTGATG
CAACTGGGTGAAAATATTATGACCGCACGCGCTGGCCTGTCAGACCCAAGGAAACCATTGGGGGTCTTTA
TGTTAGTGGGGCCTTCAGGTGTGGGTAAAACAGAGACGGCCTTAGCGATCGCCGAGAGCATGTATGGTGG
TGAACAGAATATGATCACTATCAATATGAGCGAATATCAGGAATCGCATACCGTTTCCTCTTTAAAAGGT
TCTCCACCGGGATATGTTGGATACGGTGAAGGCGGTGTGTTAACGGAAGCTGTGCGCCGTAAGCCATATA
GTGTTGTGTTGTTAGATGAAATCGAAAAAGCGCACTCTGATGTACATGAGTTATTCTTCCAAGTGTTTGA
TAAAGGCCAAATGGAAGATGGTGAAGGGCGTTTTATCGATTTTAAAAATACTATCTTGTTGTTAACCAGT
AATGTGGGCAGCGAGTTACTGAGTAACTTATTAGCTGATCCAGATACTGCACCGGATCAGGATGGAATAT
TAAGTGCGTTGCAACCTGAATTGCTGAAAGTTTTCCCCGCAGCATTTTTAGGGCGAGTTACGGTTATTCC
TTATCTTCCGTTACAGCAAGATGCATTGCAGCATATTGTACGGTTGCATTTAGATCGGATTGGCGCTCGT
TTATACTCGCAGCATCAATTGACACTGAAATACAGTGATGAAGTGGTTGAAGATGTTGTTAGCCGCTGTG
CGGTCTCAGAGACCGGTGCGCGTATGCTGATCCGTTACATTGAACAAAATATTACGCCAAAAATAGGTAA
ATATATTTTAGGTGATAGTGATGTGAAGCCTGAGCAAATTATTTTCGTTCATAAAAATGAAAATGGATTC
GTGATCGCTTTACAGTGTAAAGATGACGAAAACTAA
 Primer design