SecReT6
Protein ID: 384123171
SecReT6 ID571
T6SS typei3
Gene symbol-
Locus tagYPD4_2581
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3290053..3291888 [+]
Producthypothetical protein
NoteTssF
UniProt IDD0JEZ4
KEGG IDypd:YPD4_2581
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.30E-195, Aligned region: 1..610
Protein Sequence: 611 a.a.     [Download]
>gi|384123171|ref|YP_005505791.1| hypothetical protein YPD4_2581 [Yersinia pestis D106004]
MREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPKFTQRLLDIVYPNYNS
PTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWPLEIAEARLSSVPPDM
PNLEKHRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPIYIDGDERIVSHIFELLHASHVATIIRAGHG
ETAKDTVISDQPLSFEGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQLSQSLRDNHTGEAEI
IILLDRLPQDLVSHVAPSRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSRPLDYEVFAINKVFGQ
QAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEVFVSLVDQQEAPYGDS
LRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPSAPRAPFAMDESAWRLIRQLSFNYLP
LSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVYGRGICCTLTVDEEGF
SGISPYLFGMIMENYVARHAAINVFTETELNSMQRGRVGHWKARPGRRGVL
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|384120592|ref|NC_017154.1|:3290053-3291888 Yersinia pestis D106004 chromosome, complete genome
ATGCGCGAGATGGCGCAAGAGTTTGCTGAAAAACATCCCAAAATAGCAGGCCGCCTGGGCATGCATGGGA
TTGAAGTCGCCGACCCTTACGTTGAGCGGCTGATAGAGTCCTTCTGTTTTTTATCTGCCAGAACGCAGAT
TAAGTTGGATGCTGAGTTTCCTAAATTTACTCAGCGTCTTTTGGACATTGTCTATCCCAATTACAATTCG
CCAACCCCCTCAATGGGCGTGATCCAACTTAAGCCAAATCTGAAGGAAGGAGATTTGACTCAAGGGTATT
GTGTTCCCAGGGGCAGCTCGTTCTTCACCCATATCGCACCTGGCGAGACAACCCGCTGCGAGTTCCGCAG
TGGTCAGGATGTGGAGTTGTGGCCACTGGAAATAGCAGAAGCGCGTCTAAGCTCTGTTCCCCCGGATATG
CCTAATCTGGAAAAGCACCGCATTGCCTATCATCGGCTTAAAGGTGCCTTACGCATTAAATTAAAATTAG
TGGGCGATCTCACTTTCTCACAATTAGAAGGCCTTGATCGGCTGCCTATTTATATTGATGGTGATGAACG
AATCGTTTCACATATCTTCGAGCTACTCCACGCCAGCCATGTTGCTACCATCATACGGGCAGGCCACGGA
GAGACAGCAAAAGACACCGTGATCAGTGATCAGCCACTGTCCTTTGAAGGGCTAAGCCCCGACCAAAGCC
TACTGCCGCTATCATGGAATATCTTTCACGGACATAATCTGGTGCAGGAATACTTTACCTGCCGCCAGCG
TTTCTACTTTTTTACGCTGACACAGCTGTCGCAAAGTTTGCGCGATAATCATACCGGTGAAGCGGAAATC
ATCATCCTACTGGACAGATTACCGCAGGATTTGGTGAGCCATGTTGCCCCCTCTCGCTTCCTGTTAGCCT
GCACGCCAGTGATTAATCTCTTTCCTAAACGCATGGATAAGATCGAAATTAACCGTGCACTGAACGATTT
TCACGTAGTACCAGACCGTAGCCGCCCACTGGATTATGAGGTTTTCGCCATTAATAAAGTGTTTGGTCAA
CAGGCGGAAACCAGCAACGAGGTGGTATTTAACCCACTTTATCAAACCCGTCACTGTGATAATGGCAACT
TTGGGCGTTATTTCTCCATCACCCGCAAGGCCAGAACGGGCGATAGCAACAAAAGAAAATATGACACCCG
CACGCCTTACGCCAGTACCGAGGTCTTTGTCTCGTTGGTCGATCAACAAGAGGCTCCTTATGGCGATAGC
TTGCGCTACCTCTCTATTGAAGCTCAGGTGACTAATCGGGATCTTCCGCGCCTGATTTCCGCCAGTGGTA
ATTTTGAATTGACCATGTCGGATTCAGCGCCCGTTCACGGTGCCCGGTTTGTCTTCCAACCCAGCGCCCC
ACGCGCCCCCTTTGCCATGGATGAATCCGCCTGGCGTTTGATTCGCCAATTGAGCTTCAACTATCTGCCA
CTGTCAGATATGTCCCACTCGAATGGGGGGGAGTCACTGCGCAATATGCTACGTCTGTTTGTTAACGCTT
CAGACCATGAATCGAATACACAAATTGACGCGCTGGTGGGCTGTAAAAGCGAGCCGGTGATCCGCCGGTT
ACCCGGCAATGGCCTACTGGTTTATGGCCGGGGCATCTGCTGCACTTTGACCGTGGATGAAGAAGGATTC
TCCGGTATCAGCCCTTATCTATTTGGCATGATCATGGAAAATTATGTGGCCCGCCATGCCGCAATAAATG
TGTTTACCGAGACCGAGCTAAACTCCATGCAAAGAGGACGTGTCGGTCATTGGAAAGCCCGCCCTGGCAG
ACGAGGAGTCCTGTAA
 Primer design