SecReT6
Protein ID: 384123172
SecReT6 ID571
T6SS typei3
Gene symbol-
Locus tagYPD4_2582
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3291888..3292913 [+]
Producthypothetical protein
NoteTssG
UniProt IDD0JEZ5
KEGG IDypd:YPD4_2582
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-88, Aligned region: 22..321
Protein Sequence: 341 a.a.     [Download]
>gi|384123172|ref|YP_005505792.1| hypothetical protein YPD4_2582 [Yersinia pestis D106004]
MLPDESVHQEKHANLDAWYQESQPWNAGFISMMRANAARNPTLPAPGKAPLPEQEAFRIGQSAHMTFSPR
EISHAVMRDGKMDLQLFGLGIWGPNGAMPLQMTELAYTRAELHDHTMTDFVDLFHHRALSQLYRAWFVSQ
DTASLDRQSDEKFSFYVGSLAGLDPQELNDTELPVHARLASSAHLIREARNPEGLVGALQYYFDVPVRMV
EYAEQWIFLEESDQTQLGDGAGAMLLGDGAILGNTVLDRQHKFQLILGPLSLQQYLRFSLWGQDLPVLRE
WVRNFVGFEYAWEVQLLLSADEVPMATLDGGHQLGYTSWLARSDTTLDVGGMSFEPEMHHD
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|384120592|ref|NC_017154.1|:3291888-3292913 Yersinia pestis D106004 chromosome, complete genome
ATGTTACCCGATGAATCCGTTCACCAGGAAAAACATGCCAATCTGGACGCCTGGTATCAGGAGTCTCAGC
CATGGAACGCCGGTTTTATCAGCATGATGCGGGCGAATGCCGCCCGCAACCCTACCCTGCCAGCGCCAGG
AAAAGCGCCCTTGCCTGAACAGGAAGCCTTCCGCATCGGGCAAAGTGCGCACATGACGTTCTCTCCGCGT
GAGATATCTCACGCGGTCATGAGAGACGGGAAAATGGATCTGCAACTTTTTGGCTTAGGGATTTGGGGGC
CAAATGGTGCGATGCCGCTTCAGATGACCGAACTGGCCTATACCCGTGCCGAGTTGCATGATCATACGAT
GACGGATTTCGTCGACCTTTTTCATCACCGCGCATTATCACAGCTTTATCGGGCGTGGTTTGTCTCTCAG
GATACCGCCTCGCTAGATCGGCAGAGTGATGAAAAATTCTCCTTCTATGTCGGTAGTCTCGCCGGGCTGG
ATCCTCAAGAACTTAATGATACCGAACTCCCGGTTCATGCCCGGTTAGCCTCCTCTGCCCATTTGATTCG
TGAAGCGCGCAACCCCGAAGGGCTCGTGGGCGCATTGCAGTACTACTTTGACGTCCCCGTGCGGATGGTG
GAGTACGCCGAGCAGTGGATCTTTCTGGAAGAAAGCGACCAGACACAATTGGGTGATGGTGCAGGCGCGA
TGCTCTTGGGCGACGGTGCTATTTTGGGCAATACCGTTTTGGATCGGCAGCATAAATTTCAACTGATCCT
CGGCCCCCTCAGCCTGCAACAGTACCTGCGCTTTAGCCTCTGGGGACAAGACTTACCGGTATTGCGAGAG
TGGGTACGTAACTTTGTTGGGTTCGAATACGCCTGGGAAGTCCAGTTGTTGTTAAGCGCCGATGAGGTTC
CCATGGCAACACTCGATGGCGGACATCAATTGGGATACACCTCTTGGTTAGCCCGCAGTGATACCACCCT
TGATGTCGGTGGGATGAGTTTTGAGCCTGAAATGCATCACGATTAA
 Primer design