SecReT6
Protein ID: 384123173
SecReT6 ID571
T6SS typei3
Gene symbol-
Locus tagYPD4_2583
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3293012..3294193 [+]
Producthypothetical protein
NoteTssA
UniProt IDD0JEZ6
KEGG IDypd:YPD4_2583
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.60E-18, Aligned region: 62..121
ImpA-rel_N [PF06812], Evalue: 3.60E-18, Aligned region: 203..215
Protein Sequence: 393 a.a.     [Download]
>gi|384123173|ref|YP_005505793.1| hypothetical protein YPD4_2583 [Yersinia pestis D106004]
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKC
LELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELE
DIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGALDEGTLEAVKQEWQNRSDHTILSLQHAYALL
QGLATRLNNSLGEDTPDFVRMTSVLRHFDAAITPIAPIVVPIPEVVELYPVATAMLASTEMPVTAEVQTV
AETQMAIPIEAPQQRQAVVTPSPQLQPLQLQSAQLQPVPIQSQPVPVQQQGIQNRADALARLIEVREWFT
AMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|384120592|ref|NC_017154.1|:3293012-3294193 Yersinia pestis D106004 chromosome, complete genome
ATGAGTGAACAGAGTATCGCTGAACGTGCCGGTTATTATCAAAGCATGATGCAGCCCATTCCAGGTGACT
TTCCTTGTGGCAAAAATCTGGAATATGACCCGGCATTTATTATGCTACAGACAAAATTGCAACCTAAGCA
GGCCGCTGAATACGGCAATTTTGTTGAGGTCGCTGAACCCAATAACTGGACAGATATCGAGCGTAAATGC
CTTGAACTCCTGAATAATTCTCGGGATATTCGGCTGTTTATTATTCTGATGCGCTGCCGGATGCGTCAGG
TCGGTGTGGGCGCGTTGCAAGAAGGGCTGGAAGCCATACTTTGGTGCCTCGACACTTGGCCTGATCAGCT
ACATCCTCAGTTGTTTGATGAAGGGGAATTTGAACCTTTAATGCGCGGTAATGCTTTTGCTGAACTGGAA
GATATTGATGGTTTTATCGCCGACTTCCGTAATCAGCAGTTACCCAAAGCCGCTGGCGTGCAACTTTCCA
TCAAAGAGTTTGAAAAAGCACACTCCGTTCCTCGAGAAGAAGGGGCATTGGACGAAGGGACTCTGGAAGC
CGTTAAGCAAGAGTGGCAGAACCGATCAGATCACACCATTCTCTCACTCCAGCACGCTTATGCCTTGTTG
CAAGGATTAGCCACGCGCCTCAACAACTCCCTCGGTGAAGACACACCTGATTTTGTCAGAATGACCTCAG
TGTTACGCCACTTTGATGCCGCGATAACCCCGATAGCGCCTATCGTGGTGCCGATCCCAGAAGTTGTCGA
GCTCTATCCAGTCGCCACAGCGATGCTAGCAAGCACAGAAATGCCAGTGACCGCCGAGGTACAGACGGTT
GCAGAGACACAAATGGCCATACCCATTGAAGCTCCCCAACAGCGTCAAGCGGTGGTAACCCCATCCCCAC
AGTTGCAGCCGTTACAGTTGCAATCGGCACAGTTGCAACCTGTACCGATACAGTCACAGCCGGTGCCTGT
CCAGCAGCAAGGGATCCAAAACAGGGCTGATGCATTAGCCCGGCTTATAGAGGTGCGAGAGTGGTTTACC
GCCATGGAACCGAGTAGCCCGGTCATTGCCTTACTGGCTTTTTCAGAAAAAACTATCGGCAAAAGCTTCG
GCGAATTGCTGCAGTTCATTCCTCAGGAACTGATTTCGAAACTCAATGAAGGACAGGAGTAA
 Primer design