SecReT6
Protein ID: 384123177
SecReT6 ID571
T6SS typei3
Gene symbol-
Locus tagYPD4_2587
StrainYersinia pestis D106004
Repliconchromosome [GenBank: NC_017154] [Browse all T6SS(s) in this replicon]
Location [Strand]3297289..3298971 [+]
Producthypothetical protein
NoteTagL
UniProt IDD0JF00, D0JF00
KEGG IDypd:YPD4_2587
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.10E-18, Aligned region: 191..217
OmpA [PF00691], Evalue: 5.10E-18, Aligned region: 441..539
Protein Sequence: 560 a.a.     [Download]
>gi|384123177|ref|YP_005505797.1| hypothetical protein YPD4_2587 [Yersinia pestis D106004]
MFKVKLNKTLSLLWLAAVGALLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPKHPQVSTPIPQET
AEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQKRLTYIAEHHPSARVLTFFPF
LPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQLSNERLSHNSDNAYWTGNINLANQQPIEIT
QALQSLSQRLELQDINHSRFATQRNVMAHNLFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRH
GAWSAWLEKKFGIIPSLASTLSLPPFPAVINDQKPAMKPRVKTPVIKPTPASRGWLWSVCFAAVLLASHM
LNTLWQEKNRHEQFNQQMVPLDNISDFSAQYLARSITQLTDEGKILTTCVNTFDVTRWGLSQCKTLLSQI
NRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVERNKEKKILIVGHSDNTGSSSMNM
ALSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRRVEVLILPTQDRTRMTEPKPL
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|384120592|ref|NC_017154.1|:3297289-3298971 Yersinia pestis D106004 chromosome, complete genome
ATGTTTAAGGTTAAATTGAATAAAACGCTCTCTCTATTATGGCTGGCTGCGGTCGGCGCCCTATTGGTGA
GTGTGAATTTTAAGGGAAATGCGTTATGGAATAACGTTATTTTCATTACTTTCCTGGCGCTGATGGTTCT
TGCCATCTGGAAACATTACGCCCTCAAACCCAAACACCCCCAAGTGTCGACTCCCATTCCGCAGGAGACA
GCGGAACCTGTAGAACAGGAGAGTACGGTTATTTTAATTCTCGGTCCCTATGCTGAGAAATGGTTTAGTA
ACCCAGAATCGCCAGACAGTACACGTTTTTCCAGCCATGCGGTTTGGATATTAATCACGAATCCCGCCGC
GCTGCAAAAACGCCTCACATATATTGCTGAACATCATCCATCCGCTCGGGTATTGACCTTTTTCCCTTTC
TTGCCGGATGTCTATGAGAATGCAGCAGTGATGATGTCAAAACTCACTGTGTGGCAGAACACTTTTTCAA
CGTTATCACTGCGATCCCCCCTCCCCTGCGTATTTGCTATTTACGCGCAGTTGAGTAATGAACGCCTTAG
CCATAATTCTGATAACGCATATTGGACTGGAAATATTAATCTTGCGAACCAGCAGCCTATCGAGATTACG
CAAGCCCTACAGTCACTGAGCCAACGACTTGAGTTACAAGACATCAATCACTCAAGATTTGCAACTCAGC
GTAATGTTATGGCGCATAATTTATTTACTTGGTTGAATGAATCGGGGGTGACAAACCTTCTGCAATCTAT
TTTCTCTCGCACCCCCTTACGGCTAACAGATGTCATTTTGTCGGATAATGGCAAAGGGTTCATCAGGCAT
GGTGCCTGGTCAGCCTGGCTGGAAAAAAAGTTTGGCATCATACCAAGCTTAGCCTCAACCTTGTCACTGC
CACCTTTCCCAGCGGTGATCAATGACCAGAAGCCCGCAATGAAACCACGGGTGAAAACACCGGTGATAAA
ACCTACCCCCGCATCCCGCGGGTGGTTATGGAGTGTATGCTTCGCCGCGGTGCTATTAGCCTCACATATG
CTAAACACCCTGTGGCAAGAAAAAAACCGGCATGAGCAATTTAACCAACAGATGGTGCCGTTGGACAATA
TCAGCGATTTTTCTGCTCAGTACCTGGCACGCAGCATCACCCAGTTAACTGATGAAGGTAAAATATTAAC
CACATGCGTTAATACATTTGATGTCACACGTTGGGGGCTGTCTCAATGCAAGACGTTATTAAGCCAAATC
AACCGCCGGATTGAATCCTATGAAAATATTCCTGTTTTCAGTTTTGCCCAAAAGCTCCCTCTGTTTGACT
CAAACAGTACCAAGCTGAAACTGAACTCACAAACTAATGAAATGATGATGGAGTTGTTATCACTGGTCGA
ACGGAATAAAGAGAAAAAAATCTTAATTGTTGGCCATTCTGATAACACAGGCAGTTCCTCCATGAACATG
GCACTTTCCGAACAGCGTGCGCTGGCCCTTCGCGATTGGTTAATTAAACGCAGTGATATCACTGTCGATA
ATTTTATTACCAAGGGAATGGGGGCTTCAGAACCGGTTGCGACCAATCACACGGAAGCGGGTCGAGAACA
AAACAGACGCGTCGAAGTACTGATATTACCCACACAAGATAGAACAAGAATGACGGAGCCTAAACCTTTA
TGA
 Primer design