SecReT6
Protein ID: 384124922
SecReT6 ID573
T6SS typei3
Gene symbol-
Locus tagYPD8_0453
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]550696..554133 [+]
Producthypothetical protein
NoteTssM
UniProt IDD0JNR5
KEGG IDypx:YPD8_0453
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.70E-75, Aligned region: 479..777
DUF1215 [PF06744], Evalue: 5.00E-30, Aligned region: 886..1005
ImcF-related_N [PF14331], Evalue: 3.50E-29, Aligned region: 76..95
ImcF-related_N [PF14331], Evalue: 3.50E-29, Aligned region: 175..356
Protein Sequence: 1145 a.a.     [Download]
>gi|384124922|ref|YP_005507536.1| hypothetical protein YPD8_0453 [Yersinia pestis D182038]
MDRAADRHWPLFPSGGVWVRKIIIALILFWALWPFVAIFFSWIFRYARAPLPKRKKKTVQLDRVSARFHD
AMLTLQHADLSSQKTRWQRWRQRRKRQYIDAKPWFLVMGPPGCGKTSIVYESSEKFLLSEQYGLAQTTDI
GPTQDCNWWLTDRAVYIDTAGEWILLHGQSEEAGTARQKLFSMIRKYRRYPGVDGIVLCLDVSVLLNSSV
TERKSLADTLRLRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDELLAGGLGISMTHNEKGQNNF
VADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGLFEQIFPATPIGYTGCLRQF
WFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGPMPLRNRLLNIGKYVFVVLV
LCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQVNDNLVAAYEQLGYINTHYLESSPPLLTP
YFEHRLLNQAMLQTYHRHLNKVFWPAVQNYVTNELKKDTQSPDGDNYDTLKVYLMLGQPDHRSQEALVQW
FMSRWESFAPQGYGQNDRKLFSYHLSELFSDTASAAPKVKLNDELIRESRIKAMKTPIHIRVINRIHDAP
LPARIEDLSLADAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQLQEASEAMINEEAWVLSDG
KASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAALLARQLSDPSSPLANLVRF
STREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTPEKAVEDRFELLRRLGYALQ
SASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFSRLQIDMARQPEPVRSIMMDLLAVGQTQSL
QQSKANLSKGVSSIASDLCSNAVSGRYPFNRLASEEIGIGDFNRMFGRSGAMQSFFDQNLAPYVDTNGNR
WKVKPDSNGVVTPKTLRSFENSAQIRDTFFDASGKMAMSMIIRPISLTPSILEAVLDVDGQIINYSHGSN
QPVKVDWPGPKGGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLGVNSRELMMVMDNVSGVFKI
ELSSTMKDYPLWSKALAQFSCPKNL
 
Nucleotide Sequence: 3438 bp     [Download]
>gi|384124469|ref|NC_017160.1|:550696-554133 Yersinia pestis D182038 chromosome, complete genome
GTGGATAGGGCCGCTGATCGCCATTGGCCCCTATTTCCCTCTGGGGGGGTATGGGTTCGTAAGATCATTA
TTGCTCTGATTTTATTTTGGGCACTGTGGCCATTTGTTGCAATTTTCTTCAGTTGGATTTTTCGTTATGC
CCGTGCGCCACTTCCCAAGCGCAAGAAAAAAACGGTTCAGCTTGATCGCGTTTCTGCACGTTTTCATGAT
GCGATGCTCACCCTGCAACATGCGGATCTTTCAAGCCAGAAAACACGCTGGCAGCGCTGGCGTCAACGGC
GTAAGCGCCAGTATATCGATGCTAAACCGTGGTTTCTGGTCATGGGGCCACCCGGATGCGGTAAAACGTC
GATAGTTTATGAGAGTAGCGAGAAGTTCCTACTCTCAGAACAGTATGGTTTAGCGCAGACCACGGATATT
GGACCGACGCAGGACTGTAATTGGTGGCTGACGGATCGTGCTGTTTACATCGATACGGCAGGGGAATGGA
TCCTGCTGCATGGTCAGAGCGAAGAAGCGGGCACGGCTCGGCAAAAATTGTTCTCTATGATCCGCAAATA
TCGCCGTTATCCGGGGGTTGATGGGATTGTTCTTTGCCTTGACGTCAGCGTGCTTTTGAACTCTTCGGTG
ACGGAACGTAAGTCACTGGCTGATACGTTGCGCCTGCGGATCCTGGAAGTTGCCTCGACATTTCAGGCCG
ATATTGCGGTGTACTTGTTCCTCAACAATATCGATAAGTTACCTGGCGGCGAAACCTTCCTCTCGTTAAT
GAACGACGAACTTCTGGCCGGAGGGCTTGGGATTAGCATGACCCATAATGAAAAGGGGCAGAACAATTTC
GTTGCCGATGAAGAACGTTACCGTGAACTCCTGACACGTGTTAGCCGTTATGTGTTGGAAATACTGCACG
ATTCGCCCAACATGGAGATGCGCCACCAATTGCTGCTGTTTACAGAAAGCCTGGGAGCGCTACAAAAACC
CCTGTTTGGCTTATTCGAACAAATATTTCCGGCGACACCGATTGGCTATACCGGTTGTTTGCGGCAGTTC
TGGTTTGGCAGTACCCAAAATCTGACCTCATGGGAGGCGCTGTATTATCCGTCATCGACCAGCACCTTTG
AAAGCCGGCCTGCTGGGCAGATGTATTTCCCTGCACTGAGTCAAGCGATCACCGAAAGGGGGGTATTACA
CGCCACTGGCCCCATGCCTTTGCGAAATCGCCTGTTAAACATCGGTAAATATGTGTTCGTGGTCCTTGTG
CTCTGCATCTTATTGTTGATGCTGAGCGCCCGCTATTTTTGGGAATATGACTATATTGGCTATGCGACAG
CTCGGTTTGAGGAAACCCGTCGGATTGTGCGTGACATCCCAATCACGAATCAGGTCAACGATAATCTGGT
CGCAGCTTACGAACAGTTGGGGTATATCAACACCCATTATCTGGAAAGTTCACCGCCACTGCTGACACCG
TACTTCGAGCACCGTTTACTGAATCAGGCGATGTTGCAAACCTACCATCGTCACCTGAATAAAGTGTTCT
GGCCTGCGGTACAAAACTACGTCACCAACGAGCTGAAAAAGGACACTCAATCTCCTGACGGTGACAACTA
TGACACGCTGAAAGTTTACCTGATGCTCGGACAACCTGATCACCGCTCTCAGGAGGCATTGGTGCAATGG
TTTATGTCGCGCTGGGAAAGTTTTGCGCCTCAGGGATATGGGCAAAACGACCGCAAACTCTTCAGTTATC
ATTTGAGTGAACTGTTTTCTGACACCGCCTCAGCTGCCCCGAAAGTTAAGCTGAATGATGAGCTGATCCG
TGAATCACGCATTAAAGCGATGAAAACACCGATACACATCCGGGTGATTAATCGTATTCATGACGCCCCA
CTGCCCGCGAGGATTGAGGATCTTAGTCTGGCGGATGCCGCCGGTCCTAGCGTAACACTGATGCTGAGAC
GTAAAAGCCCCAGTACAGTAACGGATTTGGCGATCCCGGCTTTCTACACTCGGGCCAGCTACCACGATGT
GGTTAACCCACAACTTCAGGAAGCATCGGAAGCGATGATTAACGAGGAAGCGTGGGTGTTGAGTGACGGT
AAAGCTTCGGTTAGTCAGGTTAGTTTACTGGCTGCGGCGCAAAAACTGTCCGATGAAGCGCGCAAGTATT
ATCTGATGGAGTATGCCAACCAATGGGATGCATTCTTCAATGATATCAGGGTGCGCCCAATCAACGGACT
TGATGATGCGGCGCTGCTGGCAAGGCAACTCTCAGACCCGTCATCCCCGTTGGCTAATCTGGTGCGTTTC
TCCACACGGGAAATAACCCTGACCACTGACAACAATGGTAAAGGGGCGATGTCGTCAGGCTGGTTCAATA
TTCAACGTAATAAGCTCACGACTGCCCGCCGTAACATCATTGACGAAATGTCGGGTGAGCGTTCTCGTTT
TCGTCTAACGCCAGAGAAAGCGGTGGAGGATCGCTTTGAACTATTAAGACGTCTGGGATATGCCCTGCAA
AGTGCGTCTACCAGCAATTCTGATCCGTTGGGCCGAACCTTCGAGCAGATTTATAACCAGTTGATAACAC
TCTCGACTTCCCTTCGGGCTGGGCAGATTTTGCCGCAAAATAACGATTTCAGTCGCTTGCAAATCGATAT
GGCCCGTCAGCCAGAGCCGGTGCGCAGCATTATGATGGATCTGCTGGCCGTCGGACAAACGCAAAGTCTG
CAACAAAGTAAGGCCAACCTCAGCAAGGGCGTCTCTTCAATTGCTTCTGATTTATGTAGCAACGCCGTCA
GTGGCCGTTATCCCTTTAATCGGTTGGCTAGCGAAGAGATAGGTATTGGCGATTTCAACCGTATGTTTGG
TCGTTCTGGGGCGATGCAAAGCTTCTTTGATCAGAATCTCGCACCGTATGTCGATACCAACGGCAACCGC
TGGAAGGTAAAACCTGACAGTAACGGTGTGGTGACCCCTAAAACTCTGCGTTCGTTTGAAAACTCAGCAC
AAATCCGCGACACCTTCTTTGATGCCTCCGGCAAGATGGCGATGTCGATGATCATTCGCCCTATCTCACT
GACTCCATCAATTTTGGAAGCGGTTCTTGATGTCGATGGCCAGATTATTAACTACAGCCATGGTTCTAAC
CAACCGGTAAAAGTTGATTGGCCAGGACCGAAAGGTGGGGTGTATATCCGCCTGACGTTCAAAACTCAGG
ATGGAAATGTGGAAACCGTTAGCTTCAATGGTCCGTGGGCTATTTTCCGCATGTATGACGTTAGTAACCC
TAGGCCACTCGGGGTCAATAGCCGTGAACTCATGATGGTGATGGATAACGTGAGTGGCGTCTTCAAAATT
GAGTTGAGTTCCACCATGAAAGATTATCCGCTGTGGTCAAAAGCATTGGCACAGTTCTCATGTCCTAAGA
ATCTCTAA
 Primer design