SecReT6
Protein ID: 384127011
SecReT6 ID576
T6SS typei3
Gene symbol-
Locus tagYPD8_2559
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]3249795..3253586 [-]
Producthypothetical protein
NoteTssM
UniProt IDD0JP00
KEGG IDypx:YPD8_2559
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.50E-84, Aligned region: 572..887
ImcF-related_N [PF14331], Evalue: 4.80E-72, Aligned region: 239..524
DUF1215 [PF06744], Evalue: 1.10E-29, Aligned region: 614..635
DUF1215 [PF06744], Evalue: 1.10E-29, Aligned region: 1002..1115
Protein Sequence: 1263 a.a.     [Download]
>gi|384127011|ref|YP_005509625.1| hypothetical protein YPD8_2559 [Yersinia pestis D182038]
MKRILLVGCFILLAAAIWFLGPFLGFGEARPLESYEARIICILLALLLILGFWYGAPRFVIAAVVACAAV
WVIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTWCLVKALAKNPALLDNFIKHKKAAKPEAEAELS
EVNAMIRNGMNYVRRIHSGIPAWRRFFISNRWRTELPWFMVVGMKGAGKTALILSSGQDFPLPEQLNRIG
KENPPTQHCECLFSNDALFLDTSGKYIDDSKDNQTEWTGILKALKKYRPVKAINGVIVAISASDILGKSK
ADLLNVSATLRTRLDEVRAVLGVRFPVYVTITKLDQISGFDEYFRNLTAEDREQIWGVTFPYNEAKEQSD
MPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQNVFFASRFDETKF
HTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQKSDNEDRFISDVAYGKQYFLKQL
FSDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAVWLVWAFLVSFQHNEGYLQATGAKLSQLESTVM
SYAKTSNEQILPALLNATQQLPEYGTLDVANPELDWRYGLYTGSAISQGANTLYQFFLQKYLFPMVENQS
EVTLRKTMHSGQSEEVYAALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKSIFVGHLNTLFTL
KDWRQYGQPADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHATQVFTLSDDELLH
EGIPGLYTYAGYHEVVKKKLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQGYAAYWKRFLSS
VRLISVDADSAEYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLAEKEKAITDEINIRTQGQLLSQA
KKLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADVTGGNNLSVLQGTQMSRIIGTLNDQYTRFVVYN
SAFEYGDIPPLSQDGERIAVESQTWPDPFRNIIAPLLTGSSQKFENKVITHTSKAIDMGVGEICRNTLQG
RYPFAESEQIVSLNDFERFFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAFFEQAAMIRNVLF
NTNDGKKMALDFSVSVRYLAPTITQLIMNFDGNTVRYSHGPVTPAFFKWPGLRQGTIVSLTAQRQKASAM
PDILFRGPWALLQWADQADEIRDEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLLRDFKCPSVNDMN
GIW
 
Nucleotide Sequence: 3792 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c3253586-3249795 Yersinia pestis D182038 chromosome, complete genome
ATGAAACGCATATTGCTGGTCGGCTGCTTTATATTGCTGGCTGCGGCGATATGGTTTCTGGGGCCTTTCC
TCGGCTTTGGTGAGGCGCGGCCTCTCGAAAGTTATGAAGCCAGAATTATTTGCATCCTGCTGGCACTGCT
GCTGATCTTAGGTTTTTGGTACGGCGCACCGCGCTTTGTCATTGCCGCCGTCGTTGCCTGTGCTGCGGTA
TGGGTGATTGGCCCATTCATATTAGTTGGTGATGATCATCCTCTGACTGATGGGATCCGTCGCGGCATCA
TTATCGCCATCATTGCATTTATTACACTTATTTATGGCACCTGGTGCTTAGTCAAAGCATTGGCGAAAAA
TCCAGCGTTACTGGATAACTTCATTAAGCACAAGAAAGCGGCCAAGCCTGAAGCGGAGGCTGAACTTTCT
GAAGTTAATGCGATGATCCGCAATGGCATGAACTATGTGCGCCGTATTCACAGTGGTATTCCGGCCTGGC
GACGTTTCTTTATCTCCAACCGTTGGCGCACAGAACTGCCTTGGTTCATGGTTGTCGGTATGAAAGGTGC
AGGGAAAACCGCCCTTATCCTCTCTTCAGGACAGGACTTTCCTTTACCTGAGCAGCTGAATCGTATTGGC
AAAGAAAACCCACCCACTCAACATTGTGAATGTTTGTTCTCTAATGACGCCCTGTTTTTAGACACTTCAG
GGAAATACATTGATGACAGCAAAGATAATCAGACTGAGTGGACCGGGATATTAAAGGCACTCAAAAAATA
TCGTCCGGTTAAGGCAATTAATGGTGTCATTGTTGCGATTTCGGCATCCGATATCTTGGGTAAAAGTAAA
GCTGATTTACTGAATGTGTCGGCGACGCTACGCACGCGTTTGGATGAGGTTCGTGCGGTCTTGGGCGTCC
GTTTCCCGGTGTATGTCACGATTACAAAACTGGATCAAATATCGGGTTTTGATGAATATTTCCGTAATTT
AACGGCTGAAGATCGCGAGCAAATTTGGGGGGTGACTTTCCCTTATAACGAGGCGAAAGAGCAATCCGAT
ATGCCACTTCAGCAACGTATCAGCCATGAGCTGGCACTGCTTGAGGATCGTATCAGCAATAATATGCACG
TCCGCCAGCAGGAAGAGTATGCCGTGGCGGACAGAAAAGGCATGTATGCACTCCCTCAGGATTTCAGGAT
GCTCTCCCAGAGGGTAACGGAAGTTTTACAGAATGTTTTCTTCGCCTCACGCTTTGACGAAACAAAATTT
CACACGACCCTGAGAGGGATCTATTTTGTCAGCAGTTGTCAGCCTGCGGATGTTGAACTGTTAAATAACA
ACACGCTGATTCAAAAGTGGCGTAACGTTATTAATCATAAAAAACCGTTATCGCCAGCCGATTTATCACA
AAAAAGTGATAATGAAGATCGGTTTATTAGCGATGTGGCTTACGGGAAACAATATTTCCTCAAGCAGTTG
TTTAGCGATGTGATTACCAAAGATGCCGACTTAGTCAGCTATAACCTGAAAGTACAATCCAAATACCGTT
TTCAGAATCTATTGGGACACGCGGCTTGTATTGGGTTGGCAGTTTGGCTGGTTTGGGCCTTCTTGGTCAG
CTTCCAGCATAACGAGGGGTATTTACAGGCGACCGGTGCCAAGCTGAGTCAGTTAGAAAGCACGGTGATG
AGTTATGCCAAAACGTCCAATGAGCAGATCTTACCTGCGTTATTGAACGCGACACAGCAGTTACCCGAGT
ACGGTACGCTGGATGTGGCTAACCCTGAGCTTGACTGGCGTTATGGCTTATATACCGGTAGCGCAATCTC
ACAAGGTGCGAACACGCTCTATCAGTTTTTCTTGCAAAAATATCTCTTCCCAATGGTTGAGAATCAGAGT
GAGGTTACATTAAGAAAAACGATGCACTCAGGTCAGAGCGAAGAGGTTTATGCCGCGCTGAAGCTTTATT
TGATGCTGACGGGTGAAGGTAAATTTGATCGTCAATATATGATTGAGCACGTGACCCAAGATTGGCAGAA
AAGTGGAAAAATTGAGCCTTACGAAGAGAAGAGTATTTTCGTCGGTCATTTGAACACGCTGTTTACCCTG
AAAGACTGGCGGCAGTATGGGCAACCGGCAGACAGTGAACTGATTAAGCAGGCTCGGGCAATACTGGCGG
AAAAAACAGTGACCGCCAGACTTTGGGGGCGTATTCAATCCCGCTTATTGGCCGATGCCCCTGCCAATAT
GACGTTACGTAAAATGGTGGGTGAGCACGCGACACAGGTATTCACCCTGTCAGATGATGAACTACTGCAT
GAAGGGATCCCGGGGCTTTATACCTACGCGGGCTACCATGAGGTGGTTAAAAAAAAACTGACACCTTTGC
TGATGTTACTTCAGGAAGAGGATAGGTGGGTGATGGCGCAATCGCTGTCATCTTCTCTTGACCCCCTGAC
GTTAAGACAAGATGTTCTGGTGATGTATTTACAAGGGTATGCCGCTTATTGGAAACGCTTTCTCTCCAGT
GTTCGTCTGATTTCTGTCGATGCGGACAGTGCAGAGTATGCTCAAGGGCTGTCTCTGGATATTGCTTTGT
TAAGGACGTTAGTTTCAGAAAATTCACCGCTACTCAATTTAGCCAGGCAGGCGGTAAAAGAAACGACACT
CGCCGAAAAAGAAAAAGCCATTACTGATGAGATAAACATCAGAACGCAAGGGCAATTACTCAGCCAGGCT
AAAAAATTACAAGAAACGATCGCGTTTCGTGAAAATAAACTGATTAAAGAGTGGGTTGATAATCGTTTTG
AATCCCTGAGAGTCTTTGTTAATGGGGAACAGAGTGCTGATGTCACGGGGGGCAATAATCTTTCTGTTCT
TCAGGGAACGCAGATGAGCCGAATAATCGGGACATTAAACGATCAATATACCCGTTTTGTTGTTTATAAC
AGTGCCTTTGAATATGGCGATATTCCTCCGTTATCCCAGGATGGGGAACGTATTGCGGTGGAATCACAAA
CATGGCCGGATCCGTTTAGAAATATTATTGCACCGTTATTAACGGGCTCATCCCAGAAATTTGAAAATAA
AGTGATTACTCACACGTCCAAAGCGATTGATATGGGGGTGGGGGAAATTTGCCGGAATACGCTGCAAGGG
CGTTACCCATTTGCTGAAAGTGAGCAAATTGTTAGTTTGAATGATTTTGAGCGTTTCTTCGGTACTGACG
GTACGGTGGACAGTTATTTCAAGAAAAACTTGGAGAGTAAAGTCGACACGTCCTCAATACCTTGGCGTTA
TAAGGGCAGCGTAAGTAGTGAAGGTTTGGCGTTCTTTGAACAGGCGGCAATGATCAGAAACGTGCTATTT
AATACCAATGACGGTAAAAAAATGGCATTAGATTTTTCCGTATCAGTGCGTTATTTAGCACCCACTATCA
CCCAACTTATTATGAACTTTGATGGTAATACTGTGCGTTATTCCCATGGTCCCGTAACGCCAGCCTTCTT
TAAATGGCCGGGTTTACGTCAAGGCACCATTGTCAGTTTAACGGCCCAACGCCAGAAGGCATCCGCGATG
CCCGATATTCTTTTTCGCGGACCTTGGGCACTCTTGCAGTGGGCTGATCAGGCCGATGAAATTCGCGATG
AAGCGAATGGCAAACAGACGCTGACTTATCTCATGGGGAAAGATCGTGTCGAGCTTGAAGTCTCAGGTTT
AACGCATGGTGGTGAAACCATTAGCGATCTGCTGAGAGATTTCAAATGCCCCAGTGTCAATGACATGAAT
GGTATTTGGTAA
 Primer design