SecReT6
Protein ID: 384127692
SecReT6 ID577
T6SS typei1
Gene symbol-
Locus tagYPD8_3243
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]4094451..4096385 [-]
Producthypothetical protein
NoteTssM
UniProt IDD0JSV5
KEGG IDypx:YPD8_3243
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.20E-81, Aligned region: 1..289
DUF1215 [PF06744], Evalue: 1.60E-39, Aligned region: 383..502
Protein Sequence: 644 a.a.     [Download]
>gi|384127692|ref|YP_005510306.1| hypothetical protein YPD8_3243, partial [Yersinia pestis D182038]
MGLYQGNNIGPYVESTYLQLLQQRFVPALMSGLLEQLNAAPKGSEEKLEILRVMRMLEDGSGRNAALVEQ
YMSHRWSQQFNGQRELQEQLSSHLNYALKHTDWHGARESGDQYAIKSFVPYLRPIQSAQQELSKLSIYQR
VYQNLRIKAQDALPPALDLRDQIGASFDDIFVSGNDRLLVIPQFLTRSGLQSYFIKQNDQLVDLTVMDSW
VLNLTKNVEYSEADRKEIHRQVTEQYLGDYTATWRAAMNNLSVSDFEGLPQAISAIEQVISGEQPFRRAL
QTLSDNTRLPVISDLIPAKEQQELLQKPDYLLLTRINREFSPETAVLVENGDKGSVIQSVYQKLTELHRY
LLAIQNSPAPGKAALKAVQLRLDQNNSDPIFEVQQLAKNLPEPLNRWVGELAEQAWRVVMMEAIQSLEVE
WNETVIKQYQTYLAGRYPFDPHAKQDVPLSEFERFFGPKGTLDAFYQQNLKPFVENNLTGGSDGELLIRP
DVLQQLAQARKIRDTFFSAQNGLGTQFAIEPVLLSGNKRRSVLNLDGQLLDYAHGRSGVVHLVWPNSMRA
GVESKLTLVPDESGKSPRTLSFSGPWAQLRLINAGELTNVGTNSFDVRFKVDGGEMTYRIFVDESDNPFA
GGLFSKFSLPDTLY
 
Nucleotide Sequence: 1935 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c4096385-4094451 Yersinia pestis D182038 chromosome, complete genome
ATGGGGTTATATCAGGGCAATAATATCGGGCCTTATGTCGAAAGCACTTACTTGCAACTCCTACAGCAAC
GTTTTGTCCCGGCACTGATGAGCGGGCTGTTAGAACAACTGAACGCCGCGCCGAAGGGCAGTGAAGAGAA
ACTGGAAATTCTGCGGGTGATGCGGATGTTGGAAGACGGCAGTGGCCGCAATGCCGCGCTGGTTGAACAA
TATATGAGCCACCGCTGGAGCCAACAATTCAACGGCCAGCGCGAGTTGCAGGAGCAACTGTCGAGCCACC
TGAACTACGCACTGAAACACACCGACTGGCACGGCGCACGGGAAAGTGGCGATCAATATGCGATCAAGAG
CTTTGTTCCGTACCTCCGCCCGATCCAGTCAGCGCAGCAAGAGTTGAGCAAACTCTCGATCTACCAACGG
GTGTATCAGAACCTGCGGATCAAAGCACAGGATGCGTTGCCGCCCGCGCTCGATTTGCGCGATCAGATCG
GCGCAAGTTTTGACGACATCTTTGTCTCCGGTAACGATCGCCTGCTGGTGATCCCGCAATTCCTGACCCG
TAGCGGCTTACAGAGTTACTTCATCAAACAGAACGATCAACTGGTTGATCTCACGGTGATGGACAGTTGG
GTACTTAATCTCACCAAGAACGTCGAATACAGCGAGGCAGACCGCAAAGAGATCCATCGCCAGGTGACCG
AACAGTATCTTGGCGATTATACCGCCACCTGGCGTGCGGCTATGAATAACCTGTCGGTCAGTGATTTTGA
AGGCTTGCCACAGGCGATCAGCGCCATTGAACAGGTGATCAGCGGGGAACAACCTTTCCGCCGTGCACTG
CAAACGCTGAGTGACAACACCCGCTTGCCGGTTATCTCGGATCTGATCCCCGCGAAGGAGCAGCAAGAGC
TGCTGCAAAAACCCGATTACCTGCTGCTGACCCGCATCAACCGTGAGTTCTCCCCCGAAACGGCGGTGCT
GGTGGAGAATGGCGATAAAGGCAGCGTGATCCAAAGTGTTTACCAAAAACTGACCGAGCTACACCGCTAT
CTGTTGGCGATCCAAAACTCGCCCGCGCCGGGCAAAGCGGCGTTGAAGGCGGTGCAATTACGTCTGGATC
AAAACAACAGTGATCCGATTTTTGAAGTCCAGCAACTGGCTAAAAACCTGCCGGAGCCGCTAAACCGTTG
GGTGGGCGAACTGGCAGAGCAAGCCTGGCGGGTGGTGATGATGGAGGCGATCCAGTCACTGGAAGTGGAG
TGGAATGAGACGGTGATCAAACAGTATCAAACCTACCTGGCCGGACGTTATCCCTTCGATCCTCACGCGA
AACAGGATGTACCACTCAGTGAGTTTGAACGCTTCTTCGGGCCGAAAGGCACGCTCGATGCATTCTATCA
GCAGAACCTGAAACCGTTTGTCGAAAACAACCTGACCGGTGGCAGCGATGGCGAATTGCTGATCCGGCCT
GATGTGTTACAGCAACTGGCGCAGGCACGGAAAATTCGCGACACCTTCTTCTCGGCCCAAAACGGCCTGG
GCACACAGTTTGCGATTGAACCGGTGCTGTTAAGTGGCAACAAGCGCCGCAGCGTATTGAATCTGGATGG
GCAATTACTGGATTACGCCCATGGCCGCAGCGGCGTAGTGCATCTGGTTTGGCCAAACTCGATGCGTGCA
GGAGTGGAAAGCAAACTGACGTTAGTCCCGGATGAGAGCGGCAAATCACCGCGCACCCTCAGCTTCAGCG
GTCCTTGGGCGCAGTTGCGGCTGATCAACGCCGGTGAACTGACCAATGTGGGCACCAACTCCTTCGATGT
CCGCTTCAAGGTTGATGGCGGCGAGATGACGTACCGCATCTTTGTTGATGAATCCGACAACCCATTCGCG
GGCGGTTTGTTCAGTAAATTCAGTCTGCCAGACACTCTGTATTGA
 Primer design