SecReT6
Protein ID: 384127693
SecReT6 ID577
T6SS typei1
Gene symbol-
Locus tagYPD8_3244
StrainYersinia pestis D182038
Repliconchromosome [GenBank: NC_017160] [Browse all T6SS(s) in this replicon]
Location [Strand]4096529..4097983 [-]
Producthypothetical protein
NoteTssM
UniProt IDD0JSV6
KEGG IDypx:YPD8_3244
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.80E-70, Aligned region: 201..455
MMR_HSR1 [PF01926], Evalue: 0.00075, Aligned region: 133..273
DUF4131 [PF13567], Evalue: 0.0026, Aligned region: 15..93
DUF4131 [PF13567], Evalue: 0.0026, Aligned region: 444..472
Miro [PF08477], Evalue: 0.0037, Aligned region: 133..275
Protein Sequence: 484 a.a.     [Download]
>gi|384127693|ref|YP_005510307.1| hypothetical protein YPD8_3244, partial [Yersinia pestis D182038]
MKLPFFIRIAKPAIPRLKASIPVVLALMACAALIWVWIYGPEWQLGENYPFETLLSRWLVTAVFVLVAVC
WLSLKVMRRVQHLEKLQLQTKIQLDDPVSADIEQQNHYLNGWKHQLQRHLNTPEYLYRLPWYMVIGARNS
GKSTLIKEGYKLTEISASERLHAEDAADLRVRCWLGEQAVIIDPAGVLIEQPTTPIAGKASLNSRLWQSL
LSWLIEQRQRQPLNGIILTVDLHQMMTANKAQRETYVADIHQRLQEIRLSLHSQVPLYVVFTKMDLLYGF
EAMYQSLDKAEREAVLGVTFSLNAADPDVWRTELKQFWQQWVAQLNGAMPDMMLNSVDAGQRSQLFSFTR
QMQGLHDYVVQLLEGILYRGEHAQPLLRGVYLTSAQQRGQMDDIFTQSAAVQYHLAPQAFPTWPVSDTTP
YFTKALFNQVLLAEPNLAGENGIWLQKTRKRMFIFSGVGALAALTLWGYWHYITSLTTGLAKRY
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|384124469|ref|NC_017160.1|:c4097983-4096529 Yersinia pestis D182038 chromosome, complete genome
ATGAAATTGCCGTTCTTTATACGCATAGCCAAGCCCGCCATTCCTCGCCTTAAAGCGTCAATACCGGTGG
TATTGGCGTTGATGGCTTGTGCGGCACTCATTTGGGTATGGATTTACGGACCCGAGTGGCAATTGGGGGA
AAATTACCCGTTTGAGACATTATTGAGCCGTTGGTTGGTCACGGCGGTATTTGTCTTGGTGGCCGTTTGT
TGGCTCAGCCTGAAAGTCATGAGGCGAGTACAACACCTGGAAAAACTCCAACTGCAAACGAAAATTCAGC
TCGACGACCCCGTCAGTGCTGATATCGAGCAACAAAACCACTACCTCAATGGCTGGAAGCACCAACTTCA
GCGCCATTTGAACACCCCGGAATATCTGTATCGCCTGCCCTGGTACATGGTCATTGGTGCGCGCAATAGC
GGCAAAAGTACACTGATCAAAGAAGGGTATAAACTGACAGAGATCTCCGCATCCGAGCGGCTCCATGCGG
AAGACGCAGCAGATCTGCGCGTCCGCTGCTGGTTGGGGGAACAAGCGGTTATTATCGATCCTGCGGGGGT
GCTGATTGAACAACCTACGACACCGATCGCGGGCAAAGCATCACTCAACAGCCGCTTATGGCAAAGTCTA
TTATCCTGGCTGATTGAACAGCGCCAGCGTCAGCCGCTAAACGGCATTATTCTCACCGTCGATCTTCATC
AGATGATGACCGCGAATAAAGCGCAGCGGGAGACTTACGTCGCTGATATTCATCAACGGCTGCAAGAGAT
ACGGCTGTCTTTGCACAGCCAGGTGCCGCTGTATGTGGTGTTCACCAAAATGGACCTGCTGTACGGCTTC
GAGGCCATGTACCAATCGCTGGATAAAGCCGAACGTGAAGCGGTTCTGGGGGTGACGTTCAGCCTCAATG
CGGCGGATCCGGACGTGTGGCGGACGGAGTTGAAACAGTTCTGGCAGCAATGGGTCGCACAACTGAATGG
CGCGATGCCGGACATGATGCTGAACAGTGTGGATGCCGGGCAGCGTAGCCAGTTGTTTAGCTTCACTCGC
CAGATGCAGGGCCTGCACGATTACGTCGTGCAACTGCTGGAAGGCATTCTGTACCGTGGAGAACATGCCC
AGCCGCTGTTACGGGGGGTTTATCTCACGTCTGCCCAGCAACGCGGGCAAATGGACGATATCTTTACCCA
ATCTGCCGCGGTGCAATATCACCTTGCGCCACAGGCCTTCCCGACCTGGCCGGTCTCGGATACGACGCCG
TATTTTACCAAAGCGCTGTTTAACCAGGTGCTATTGGCCGAACCCAATCTGGCCGGAGAGAACGGTATCT
GGCTGCAAAAAACGAGAAAGCGAATGTTCATTTTCTCGGGGGTGGGTGCCCTGGCCGCGCTGACCTTATG
GGGCTACTGGCACTATATCACCAGCTTAACTACCGGGCTGGCGAAGAGGTATTAA
 Primer design