SecReT6
Protein ID: 384131711
SecReT6 ID578
T6SS typei4b
Gene symbol-
Locus tagABK1_1751
StrainAcinetobacter baumannii 1656-2
Repliconchromosome [GenBank: NC_017162] [Browse all T6SS(s) in this replicon]
Location [Strand]1858925..1860586 [+]
Producthypothetical protein
NoteTssM
UniProt IDE8PB14
KEGG IDabx:ABK1_1751
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 1.60E-25, Aligned region: 53..77
DUF1215 [PF06744], Evalue: 1.60E-25, Aligned region: 247..359
IcmF-related [PF06761], Evalue: 5.70E-24, Aligned region: 6..116
IcmF-related [PF06761], Evalue: 5.70E-24, Aligned region: 220..230
Protein Sequence: 553 a.a.     [Download]
>gi|384131711|ref|YP_005514323.1| hypothetical protein, partial [Acinetobacter baumannii 1656-2]
MGSYALPGVFTQKAWNEYVEKAIEEAADKPTDTKDWVLNSRQSDDLTFSGSPEQIRKQLTALYKQEYIAE
WRKFLSGIHYAKATQFAQQVKNIDVLGEPQNSPIRMLIERVAIETNWDNPVVQAELAAPQKGFIAWFKRK
VLNHDDKQLANQAVTNAQGPISQEYQMFYQLVRKRDDQQGKSLLDEYMTNLALVRSKFNELKNAGEIGPN
AMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFSEIDQQLLQKLVVSPLTQAFESLITPTQDEINKLWVMQA
YQPFTANLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKESLDPFVIRRGYTLTSKTWKDLGISLNP
QFVMNFQRYVAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSYTVDIDGQRMTYENGVQQWVNF
IWPNQGSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGFEMLWRSKTDPSLFVKMNFRL
ISSNSGSIGSSRGYSGMQLVDKVTADKAARVVSAQQAPAQAAAPAKTENPVSALAQPAAGVKP
 
Nucleotide Sequence: 1662 bp     [Download]
>gi|384129960|ref|NC_017162.1|:1858925-1860586 Acinetobacter baumannii 1656-2 chromosome, complete genome
TTGGGTAGTTATGCATTACCAGGGGTATTTACTCAAAAAGCTTGGAACGAGTATGTAGAAAAAGCAATTG
AGGAAGCAGCAGACAAACCTACGGATACTAAAGACTGGGTGCTTAATAGCCGTCAATCTGATGATTTAAC
TTTCTCAGGTAGTCCAGAGCAAATCAGAAAGCAGCTTACTGCATTGTATAAACAAGAATATATTGCAGAG
TGGAGAAAATTCTTAAGTGGCATTCACTATGCAAAAGCAACTCAGTTTGCTCAGCAAGTTAAAAATATTG
ATGTATTGGGCGAACCACAAAATTCACCAATTCGCATGCTTATTGAACGCGTAGCCATTGAAACAAACTG
GGATAATCCGGTTGTTCAAGCAGAGTTAGCAGCGCCTCAAAAAGGATTTATTGCATGGTTTAAACGTAAG
GTTTTAAACCATGATGATAAACAATTAGCAAATCAGGCTGTAACGAATGCTCAAGGGCCTATTTCTCAAG
AATATCAAATGTTCTATCAATTGGTTCGTAAACGTGATGATCAGCAAGGTAAATCTTTGCTTGATGAATA
TATGACGAATCTTGCCTTAGTACGTAGTAAGTTTAATGAACTTAAGAATGCGGGTGAGATCGGACCGAAT
GCGATGACATTGGTTAAGCAAACTTTAAATGAGCAGACATCGGTATTTAACCAGACTCAAAAAATTGTAG
ATGAAAAGATGGCGGTTGGTTTCAGTGAAATTGATCAGCAACTTCTACAAAAATTAGTGGTGAGTCCACT
TACCCAAGCCTTTGAAAGTTTAATTACACCTACTCAAGATGAAATTAATAAGCTATGGGTAATGCAAGCC
TATCAACCATTTACTGCAAATCTTGCTAAGAAATATCCATTTAACTCATCAGCTTCTTTACAAGCAACAA
GTAGTGAAATTGGACAAATTCTTGGTGAGAACGGCAGTATTTCCCGTTTTGTTAAAGAGAGTTTAGACCC
GTTTGTTATCCGCCGCGGTTATACCTTAACCTCCAAAACATGGAAAGATTTGGGGATTAGTTTAAACCCA
CAATTTGTTATGAACTTCCAACGCTATGTTGCACCTACAAATGGAATGGCAACAGGTGAGTTAAATAGCC
AAGCACCAGCTGCTCCGGCAACTAATCAGTCTAACTTCCAGTTCTACCCAATTCAAAACCCGCAGTTACT
TTCATATACCGTTGATATTGATGGTCAGCGTATGACTTATGAAAATGGGGTGCAGCAATGGGTTAACTTT
ATTTGGCCAAATCAAGGCAGTATTCCGGGTGCTCGTATTACGGCTGTAGATTTACAAGGTCAAACACATA
CCATTTTTGATGAACCAGGCGAATACGGGATTAACCGTTTAATCGATAGTGCACAGCGTAAAGAGCAAAA
CGGTGGTTTTGAAATGCTTTGGCGCAGTAAGACAGATCCATCACTCTTTGTGAAAATGAACTTCCGTCTT
ATTAGTAGTAATTCAGGAAGTATCGGTTCAAGCCGTGGCTACTCTGGTATGCAACTGGTTGACAAAGTAA
CTGCGGATAAGGCTGCTCGCGTTGTATCCGCACAGCAAGCACCAGCTCAGGCAGCTGCTCCTGCCAAAAC
TGAAAATCCAGTTTCTGCACTAGCACAACCTGCTGCGGGAGTTAAGCCATGA
 Primer design