SecReT6
Protein ID: 384137497
SecReT6 ID580
T6SS typei3
Gene symbol-
Locus tagA1122_02500
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]547540..550980 [-]
Producthypothetical protein
NoteTssM
UniProt IDG0JDG5
KEGG IDypt:A1122_02500
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.70E-75, Aligned region: 480..778
DUF1215 [PF06744], Evalue: 5.00E-30, Aligned region: 887..1006
ImcF-related_N [PF14331], Evalue: 3.50E-29, Aligned region: 77..96
ImcF-related_N [PF14331], Evalue: 3.50E-29, Aligned region: 176..357
Protein Sequence: 1146 a.a.     [Download]
>gi|384137497|ref|YP_005520199.1| hypothetical protein A1122_02500 [Yersinia pestis A1122]
MVDRAADRHWPLFPSGGVWVRKIIIALILFWALWPFVAIFFSWIFRYARAPLPKRKKKTVQLDRVSARFH
DAMLTLQHADLSSQKTRWQRWRQRRKRQYIDAKPWFLVMGPPGCGKTSIVYESSEKFLLSEQYGLAQTTD
IGPTQDCNWWLTDRAVYIDTAGEWILLHGQSEEAGTARQKLFSMIRKYRRYPGVDGIVLCLDVSVLLNSS
VTERKSLADTLRLRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDELLAGGLGISMTHNEKGQNN
FVADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGLFEQIFPATPIGYTGCLRQ
FWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGPMPLRNRLLNIGKYVFVVL
VLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQVNDNLVAAYEQLGYINTHYLESSPPLLT
PYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYVTNELKKDTQSPDGDNYDTLKVYLMLGQPDHRSQEALVQ
WFMSRWESFAPQGYGQNDRKLFSYHLSELFSDTASAAPKVKLNDELIRESRIKAMKTPIHIRVINRIHDA
PLPARIEDLSLADAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQLQEASEAMINEEAWVLSD
GKASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAALLARQLSDPSSPLANLVR
FSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTPEKAVEDRFELLRRLGYAL
QSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFSRLQIDMARQPEPVRSIMMDLLAVGQTQS
LQQSKANLSKGVSSIASDLCSNAVSGRYPFNRLASEEIGIGDFNRMFGRSGAMQSFFDQNLAPYVDTNGN
RWKVKPDSNGVVTPKTLRSFENSAQIRDTFFDASGKMAMSMIIRPISLTPSILEAVLDVDGQIINYSHGS
NQPVKVDWPGPKGGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLGVNSRELMMVMDNVSGVFK
IELSSTMKDYPLWSKALAQFSCPKNL
 
Nucleotide Sequence: 3441 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c550980-547540 Yersinia pestis A1122 chromosome, complete genome
GTGGTGGATAGGGCCGCTGATCGCCATTGGCCCCTATTTCCCTCTGGGGGGGTATGGGTTCGTAAGATCA
TTATTGCTCTGATTTTATTTTGGGCACTGTGGCCATTTGTTGCAATTTTCTTCAGTTGGATTTTTCGTTA
TGCCCGTGCGCCACTTCCCAAGCGCAAGAAAAAAACGGTTCAGCTTGATCGCGTTTCTGCACGTTTTCAT
GATGCGATGCTCACCCTGCAACATGCGGATCTTTCAAGCCAGAAAACACGCTGGCAGCGCTGGCGTCAAC
GGCGTAAGCGCCAGTATATCGATGCTAAACCGTGGTTTCTGGTCATGGGGCCACCCGGATGCGGTAAAAC
GTCGATAGTTTATGAGAGTAGCGAGAAGTTCCTACTCTCAGAACAGTATGGTTTAGCGCAGACCACGGAT
ATTGGACCGACGCAGGACTGTAATTGGTGGCTGACGGATCGTGCTGTTTACATCGATACGGCAGGGGAAT
GGATCCTGCTGCATGGTCAGAGCGAAGAAGCGGGCACGGCTCGGCAAAAATTGTTCTCTATGATCCGCAA
ATATCGCCGTTATCCGGGGGTTGATGGGATTGTTCTTTGCCTTGACGTCAGCGTGCTTTTGAACTCTTCG
GTGACGGAACGTAAGTCACTGGCTGATACGTTGCGCCTGCGGATCCTGGAAGTTGCCTCGACATTTCAGG
CCGATATTGCGGTGTACTTGTTCCTCAACAATATCGATAAGTTACCTGGCGGCGAAACCTTCCTCTCGTT
AATGAACGACGAACTTCTGGCCGGAGGGCTTGGGATTAGCATGACCCATAATGAAAAGGGGCAGAACAAT
TTCGTTGCCGATGAAGAACGTTACCGTGAACTCCTGACACGTGTTAGCCGTTATGTGTTGGAAATACTGC
ACGATTCGCCCAACATGGAGATGCGCCACCAATTGCTGCTGTTTACAGAAAGCCTGGGAGCGCTACAAAA
ACCCCTGTTTGGCTTATTCGAACAAATATTTCCGGCGACACCGATTGGCTATACCGGTTGTTTGCGGCAG
TTCTGGTTTGGCAGTACCCAAAATCTGACCTCATGGGAGGCGCTGTATTATCCGTCATCGACCAGCACCT
TTGAAAGCCGGCCTGCTGGGCAGATGTATTTCCCTGCACTGAGTCAAGCGATCACCGAAAGGGGGGTATT
ACACGCCACTGGCCCCATGCCTTTGCGAAATCGCCTGTTAAACATCGGTAAATATGTGTTCGTGGTCCTT
GTGCTCTGCATCTTATTGTTGATGCTGAGCGCCCGCTATTTTTGGGAATATGACTATATTGGCTATGCGA
CAGCTCGGTTTGAGGAAACCCGTCGGATTGTGCGTGACATCCCAATCACGAATCAGGTCAACGATAATCT
GGTCGCAGCTTACGAACAGTTGGGGTATATCAACACCCATTATCTGGAAAGTTCACCGCCACTGCTGACA
CCGTACTTCGAGCACCGTTTACTGAATCAGGCGATGTTGCAAACCTACCATCGTCACCTGAATAAAGTGT
TCTGGCCTGCGGTACAAAACTACGTCACCAACGAGCTGAAAAAGGACACTCAATCTCCTGACGGTGACAA
CTATGACACGCTGAAAGTTTACCTGATGCTCGGACAACCTGATCACCGCTCTCAGGAGGCATTGGTGCAA
TGGTTTATGTCGCGCTGGGAAAGTTTTGCGCCTCAGGGATATGGGCAAAACGACCGCAAACTCTTCAGTT
ATCATTTGAGTGAACTGTTTTCTGACACCGCCTCAGCTGCCCCGAAAGTTAAGCTGAATGATGAGCTGAT
CCGTGAATCACGCATTAAAGCGATGAAAACACCGATACACATCCGGGTGATTAATCGTATTCATGACGCC
CCACTGCCCGCGAGGATTGAGGATCTTAGTCTGGCGGATGCCGCCGGTCCTAGCGTAACACTGATGCTGA
GACGTAAAAGCCCCAGTACAGTAACGGATTTGGCGATCCCGGCTTTCTACACTCGGGCCAGCTACCACGA
TGTGGTTAACCCACAACTTCAGGAAGCATCGGAAGCGATGATTAACGAGGAAGCGTGGGTGTTGAGTGAC
GGTAAAGCTTCGGTTAGTCAGGTTAGTTTACTGGCTGCGGCGCAAAAACTGTCCGATGAAGCGCGCAAGT
ATTATCTGATGGAGTATGCCAACCAATGGGATGCATTCTTCAATGATATCAGGGTGCGCCCAATCAACGG
ACTTGATGATGCGGCGCTGCTGGCAAGGCAACTCTCAGACCCGTCATCCCCGTTGGCTAATCTGGTGCGT
TTCTCCACACGGGAAATAACCCTGACCACTGACAACAATGGTAAAGGGGCGATGTCGTCAGGCTGGTTCA
ATATTCAACGTAATAAGCTCACGACTGCCCGCCGTAACATCATTGACGAAATGTCGGGTGAGCGTTCTCG
TTTTCGTCTAACGCCAGAGAAAGCGGTGGAGGATCGCTTTGAACTATTAAGACGTCTGGGATATGCCCTG
CAAAGTGCGTCTACCAGCAATTCTGATCCGTTGGGCCGAACCTTCGAGCAGATTTATAACCAGTTGATAA
CACTCTCGACTTCCCTTCGGGCTGGGCAGATTTTGCCGCAAAATAACGATTTCAGTCGCTTGCAAATCGA
TATGGCCCGTCAGCCAGAGCCGGTGCGCAGCATTATGATGGATCTGCTGGCCGTCGGACAAACGCAAAGT
CTGCAACAAAGTAAGGCCAACCTCAGCAAGGGCGTCTCTTCAATTGCTTCTGATTTATGTAGCAACGCCG
TCAGTGGCCGTTATCCCTTTAATCGGTTGGCTAGCGAAGAGATAGGTATTGGCGATTTCAACCGTATGTT
TGGTCGTTCTGGGGCGATGCAAAGCTTCTTTGATCAGAATCTCGCACCGTATGTCGATACCAACGGCAAC
CGCTGGAAGGTAAAACCTGACAGTAACGGTGTGGTGACCCCTAAAACTCTGCGTTCGTTTGAAAACTCAG
CACAAATCCGCGACACCTTCTTTGATGCCTCCGGCAAGATGGCGATGTCGATGATCATTCGCCCTATCTC
ACTGACTCCATCAATTTTGGAAGCGGTTCTTGATGTCGATGGCCAGATTATTAACTACAGCCATGGTTCT
AACCAACCGGTAAAAGTTGATTGGCCAGGACCGAAAGGTGGGGTGTATATCCGCCTGACGTTCAAAACTC
AGGATGGAAATGTGGAAACCGTTAGCTTCAATGGTCCGTGGGCTATTTTCCGCATGTATGACGTTAGTAA
CCCTAGGCCACTCGGGGTCAATAGCCGTGAACTCATGATGGTGATGGATAACGTGAGTGGCGTCTTCAAA
ATTGAGTTGAGTTCCACCATGAAAGATTATCCGCTGTGGTCAAAAGCATTGGCACAGTTCTCATGTCCTA
AGAATCTCTAA
 Primer design