SecReT6
Protein ID: 384139436
SecReT6 ID583
T6SS typeN/A
Gene symbol-
Locus tagA1122_12430
StrainYersinia pestis A1122
Repliconchromosome [GenBank: NC_017168] [Browse all T6SS(s) in this replicon]
Location [Strand]2706898..2710725 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDG0JI54
KEGG IDypt:A1122_12430
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.60E-84, Aligned region: 584..899
ImcF-related_N [PF14331], Evalue: 4.90E-72, Aligned region: 251..536
DUF1215 [PF06744], Evalue: 1.10E-29, Aligned region: 626..647
DUF1215 [PF06744], Evalue: 1.10E-29, Aligned region: 1014..1127
Protein Sequence: 1275 a.a.     [Download]
>gi|384139436|ref|YP_005522138.1| type VI secretion protein IcmF [Yersinia pestis A1122]
MSYLNRLFSGWAMKRILLVGCFILLAAAIWFLGPFLGFGEARPLESYEARIICILLALLLILGFWYGAPR
FVIAAVVACAAVWVIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTWCLVKALAKNPALLDNFIKHK
KAAKPEAEAELSEVNAMIRNGMNYVRRIHSGIPAWRRFFISNRWRTELPWFMVVGMKGAGKTALILSSGQ
DFPLPEQLNRIGKENPPTQHCECLFSNDALFLDTSGKYIDDSKDNQTEWTGILKALKKYRPVKAINGVIV
AISASDILGKSKADLLNVSATLRTRLDEVRAVLGVRFPVYVTITKLDQISGFDEYFRNLTAEDREQIWGV
TFPYNEAKEQSDMPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQN
VFFASRFDETKFHTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQKSDNEDRFISD
VAYGKQYFLKQLFSDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAVWLVWAFLVSFQHNEGYLQAT
GAKLSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLDVANPELDWRYGLYTGSAISQGANTLYQFFL
QKYLFPMVENQSEVTLRKTMHSGQSEEVYAALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKS
IFVGHLNTLFTLKDWRQYGQPADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHAT
QVFTLSDDELLHEGIPGLYTYAGYHEVVKKKLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQ
GYAAYWKRFLSSVRLISVDADSAEYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLAEKEKAITDEI
NIRTQGQLLSQAKKLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADVTGGNNLSVLQGTQMSRIIGT
LNDQYTRFVVYNSAFEYGDIPPLSQDGERIAVESQTWPDPFRNIIAPLLTGSSQKFENKVITHTSKAIDM
GVGEICRNTLQGRYPFAESEQIVSLNDFERFFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAF
FEQAAMIRNVLFNTNDGKKMALDFSVSVRYLAPTITQLIMNFDGNTVRYSHGPVTPAFFKWPGLRQGTIV
SLTAQRQKASAMPDILFRGPWALLQWADQADEIRDEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLL
RDFKCPSVNDMNGIW
 
Nucleotide Sequence: 3828 bp     [Download]
>gi|384137007|ref|NC_017168.1|:c2710725-2706898 Yersinia pestis A1122 chromosome, complete genome
ATGTCTTATTTGAATCGATTGTTTTCTGGCTGGGCCATGAAACGCATATTGCTGGTCGGCTGCTTTATAT
TGCTGGCTGCGGCGATATGGTTTCTGGGGCCTTTCCTCGGCTTTGGTGAGGCGCGGCCTCTCGAAAGTTA
TGAAGCCAGAATTATTTGCATCCTGCTGGCACTGCTGCTGATCTTAGGTTTTTGGTACGGCGCACCGCGC
TTTGTCATTGCCGCCGTCGTTGCCTGTGCTGCGGTATGGGTGATTGGCCCATTCATATTAGTTGGTGATG
ATCATCCTCTGACTGATGGGATCCGTCGCGGCATCATTATCGCCATCATTGCATTTATTACACTTATTTA
TGGCACCTGGTGCTTAGTCAAAGCATTGGCGAAAAATCCAGCGTTACTGGATAACTTCATTAAGCACAAG
AAAGCGGCCAAGCCTGAAGCGGAGGCTGAACTTTCTGAAGTTAATGCGATGATCCGCAATGGCATGAACT
ATGTGCGCCGTATTCACAGTGGTATTCCGGCCTGGCGACGTTTCTTTATCTCCAACCGTTGGCGCACAGA
ACTGCCTTGGTTCATGGTTGTCGGTATGAAAGGTGCAGGGAAAACCGCCCTTATCCTCTCTTCAGGACAG
GACTTTCCTTTACCTGAGCAGCTGAATCGTATTGGCAAAGAAAACCCACCCACTCAACATTGTGAATGTT
TGTTCTCTAATGACGCCCTGTTTTTAGACACTTCAGGGAAATACATTGATGACAGCAAAGATAATCAGAC
TGAGTGGACCGGGATATTAAAGGCACTCAAAAAATATCGTCCGGTTAAGGCAATTAATGGTGTCATTGTT
GCGATTTCGGCATCCGATATCTTGGGTAAAAGTAAAGCTGATTTACTGAATGTGTCGGCGACGCTACGCA
CGCGTTTGGATGAGGTTCGTGCGGTCTTGGGCGTCCGTTTCCCGGTGTATGTCACGATTACAAAACTGGA
TCAAATATCGGGTTTTGATGAATATTTCCGTAATTTAACGGCTGAAGATCGCGAGCAAATTTGGGGGGTG
ACTTTCCCTTATAACGAGGCGAAAGAGCAATCCGATATGCCACTTCAGCAACGTATCAGCCATGAGCTGG
CACTGCTTGAGGATCGTATCAGCAATAATATGCACGTCCGCCAGCAGGAAGAGTATGCCGTGGCGGACAG
AAAAGGCATGTATGCACTCCCTCAGGATTTCAGGATGCTCTCCCAGAGGGTAACGGAAGTTTTACAGAAT
GTTTTCTTCGCCTCACGCTTTGACGAAACAAAATTTCACACGACCCTGAGAGGGATCTATTTTGTCAGCA
GTTGTCAGCCTGCGGATGTTGAACTGTTAAATAACAACACGCTGATTCAAAAGTGGCGTAACGTTATTAA
TCATAAAAAACCGTTATCGCCAGCCGATTTATCACAAAAAAGTGATAATGAAGATCGGTTTATTAGCGAT
GTGGCTTACGGGAAACAATATTTCCTCAAGCAGTTGTTTAGCGATGTGATTACCAAAGATGCCGACTTAG
TCAGCTATAACCTGAAAGTACAATCCAAATACCGTTTTCAGAATCTATTGGGACACGCGGCTTGTATTGG
GTTGGCAGTTTGGCTGGTTTGGGCCTTCTTGGTCAGCTTCCAGCATAACGAGGGGTATTTACAGGCGACC
GGTGCCAAGCTGAGTCAGTTAGAAAGCACGGTGATGAGTTATGCCAAAACGTCCAATGAGCAGATCTTAC
CTGCGTTATTGAACGCGACACAGCAGTTACCCGAGTACGGTACGCTGGATGTGGCTAACCCTGAGCTTGA
CTGGCGTTATGGCTTATATACCGGTAGCGCAATCTCACAAGGTGCGAACACGCTCTATCAGTTTTTCTTG
CAAAAATATCTCTTCCCAATGGTTGAGAATCAGAGTGAGGTTACATTAAGAAAAACGATGCACTCAGGTC
AGAGCGAAGAGGTTTATGCCGCGCTGAAGCTTTATTTGATGCTGACGGGTGAAGGTAAATTTGATCGTCA
ATATATGATTGAGCACGTGACCCAAGATTGGCAGAAAAGTGGAAAAATTGAGCCTTACGAAGAGAAGAGT
ATTTTCGTCGGTCATTTGAACACGCTGTTTACCCTGAAAGACTGGCGGCAGTATGGGCAACCGGCAGACA
GTGAACTGATTAAGCAGGCTCGGGCAATACTGGCGGAAAAAACAGTGACCGCCAGACTTTGGGGGCGTAT
TCAATCCCGCTTATTGGCCGATGCCCCTGCCAATATGACGTTACGTAAAATGGTGGGTGAGCACGCGACA
CAGGTATTCACCCTGTCAGATGATGAACTACTGCATGAAGGGATCCCGGGGCTTTATACCTACGCGGGCT
ACCATGAGGTGGTTAAAAAAAAACTGACACCTTTGCTGATGTTACTTCAGGAAGAGGATAGGTGGGTGAT
GGCGCAATCGCTGTCATCTTCTCTTGACCCCCTGACGTTAAGACAAGATGTTCTGGTGATGTATTTACAA
GGGTATGCCGCTTATTGGAAACGCTTTCTCTCCAGTGTTCGTCTGATTTCTGTCGATGCGGACAGTGCAG
AGTATGCTCAAGGGCTGTCTCTGGATATTGCTTTGTTAAGGACGTTAGTTTCAGAAAATTCACCGCTACT
CAATTTAGCCAGGCAGGCGGTAAAAGAAACGACACTCGCCGAAAAAGAAAAAGCCATTACTGATGAGATA
AACATCAGAACGCAAGGGCAATTACTCAGCCAGGCTAAAAAATTACAAGAAACGATCGCGTTTCGTGAAA
ATAAACTGATTAAAGAGTGGGTTGATAATCGTTTTGAATCCCTGAGAGTCTTTGTTAATGGGGAACAGAG
TGCTGATGTCACGGGGGGCAATAATCTTTCTGTTCTTCAGGGAACGCAGATGAGCCGAATAATCGGGACA
TTAAACGATCAATATACCCGTTTTGTTGTTTATAACAGTGCCTTTGAATATGGCGATATTCCTCCGTTAT
CCCAGGATGGGGAACGTATTGCGGTGGAATCACAAACATGGCCGGATCCGTTTAGAAATATTATTGCACC
GTTATTAACGGGCTCATCCCAGAAATTTGAAAATAAAGTGATTACTCACACGTCCAAAGCGATTGATATG
GGGGTGGGGGAAATTTGCCGGAATACGCTGCAAGGGCGTTACCCATTTGCTGAAAGTGAGCAAATTGTTA
GTTTGAATGATTTTGAGCGTTTCTTCGGTACTGACGGTACGGTGGACAGTTATTTCAAGAAAAACTTGGA
GAGTAAAGTCGACACGTCCTCAATACCTTGGCGTTATAAGGGCAGCGTAAGTAGTGAAGGTTTGGCGTTC
TTTGAACAGGCGGCAATGATCAGAAACGTGCTATTTAATACCAATGACGGTAAAAAAATGGCATTAGATT
TTTCCGTATCAGTGCGTTATTTAGCACCCACTATCACCCAACTTATTATGAACTTTGATGGTAATACTGT
GCGTTATTCCCATGGTCCCGTAACGCCAGCCTTCTTTAAATGGCCGGGTTTACGTCAAGGCACCATTGTC
AGTTTAACGGCCCAACGCCAGAAGGCATCCGCGATGCCCGATATTCTTTTTCGCGGACCTTGGGCACTCT
TGCAGTGGGCTGATCAGGCCGATGAAATTCGCGATGAAGCGAATGGCAAACAGACGCTGACTTATCTCAT
GGGGAAAGATCGTGTCGAGCTTGAAGTCTCAGGTTTAACGCATGGTGGTGAAACCATTAGCGATCTGCTG
AGAGATTTCAAATGCCCCAGTGTCAATGACATGAATGGTATTTGGTAA
 Primer design