SecReT6
Protein ID: 384172994
SecReT6 ID586
T6SS typei1
Gene symbol-
Locus tagABLL_2179
StrainArcobacter sp. L
Repliconchromosome [GenBank: NC_017192] [Browse all T6SS(s) in this replicon]
Location [Strand]2230436..2233801 [-]
Producthypothetical protein
NoteTssM
UniProt IDG2HY51
KEGG IDarc:ABLL_2179
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-55, Aligned region: 74..111
ImcF-related_N [PF14331], Evalue: 3.50E-55, Aligned region: 182..362
ImcF-related_N [PF14331], Evalue: 3.50E-55, Aligned region: 366..413
IcmF-related [PF06761], Evalue: 5.40E-47, Aligned region: 494..753
DUF1215 [PF06744], Evalue: 1.10E-19, Aligned region: 863..984
Protein Sequence: 1121 a.a.     [Download]
>gi|384172994|ref|YP_005554371.1| hypothetical protein [Arcobacter sp. L]
MINFNFKKISIWAITISLVISLSIIFITPFIFESFKDLSFRLLISFTIFFLTVIILLLISLLRKKETQEV
LEERILRNEYKKIINKKIKSLKSKFNKALRIVKNSSIYRFKSKYELPWYLIMGEKLEGKTSFIESSGLNF
PINYEDTYQNEEDEKFKWYFAEHSIFVDLPGNYIQQKDNPEDPIIWKYFLKFFIKRRWKRPINGIILAIS
IDTLQNKNNKELDNFAKNLRDRFDELSSAFMSSIPIYILITKTDKVEGFENYFNNLNGDEKDEILGVTFE
EESLNDNNITQDFSSLLKRLNSSILDKMHFEWDLDNRGKIFLFTEKMSQILSKINYFVDTCFTETRYRKP
LMLRGVYFTSIKKDYESSGKSKALFVKKLLENVIFEESEIGKIDENYKKKVKRNQIISYVASLTFLIFCG
FFMMNNFINTNEKLNELENSYKEYSNLRNIVDYKSEFKDSNKLFNLVNKIQKDEFELRNNSFFNSFIFKY
KDRSEELKRLYYSDLLRILLPQVANKIQNNITINLDDFSKTWDSTKAYLMLEILEKRDKDFLITYMSNDW
NQTYSKDEILKNDLLSHWKYLLNEGFNSFDTSKQVIETARNRLIQLSAERLTYEDWKSKFSYLSSKDFSF
EKVLGNNSSLFIGSDIKIPGLFTKLGYEAVVLDGKRVLNDILLNNWVIGQKVDLNEKEKDEYFEKIMSFY
FNDYKTFWNEALINLNIISYDEIEKLNEQLAILTSSDSPILIILKHLKENTELYSSSEKVKDTLDINNQT
ISELTSNIALNKLDNFDVNSVSMIREFFKPYNDLLDEKYQSKNLLNTLFEEFNKTYEIMSNINGSVNFEE
DAFKIVSNRVHGKVAPLLNQLKLMPPQVKKWYEVVMQGNLVFISKGAKSYINKKYRRMVLSFYKERIKGK
YPADITNDDNFIKLDDFNEFFRKDGVLDNFYKEYISGFIDIDYEKSTARARNIDGNKLNFSKEFINSLIK
AQNIRNVFFKNDGSFGTIFSIKPHTLGENLATAEITFDNTSIVYEHGPIIMKKINWPSDSLNSSVKLKLY
DLSNKIVVEDYINNDWALFKFIDKSKNLTVKDDSLIVSFEKYDFKSSFEIGGVSRLYNSGNTLSFSIPNN
I
 
Nucleotide Sequence: 3366 bp     [Download]
>gi|384170815|ref|NC_017192.1|:c2233801-2230436 Arcobacter sp. L, complete genome
ATGATAAATTTTAATTTTAAAAAGATTTCAATTTGGGCTATTACAATATCTTTAGTTATATCTTTGTCAA
TTATTTTCATTACACCTTTTATATTTGAAAGTTTTAAAGATTTATCTTTTAGATTATTGATTTCATTTAC
TATTTTTTTTCTTACAGTAATAATATTATTATTGATTTCTTTACTAAGAAAAAAAGAAACACAAGAAGTT
TTAGAAGAAAGAATTTTGAGAAATGAATATAAAAAAATTATTAATAAAAAAATAAAGAGTTTAAAATCTA
AGTTTAATAAAGCATTGAGAATAGTCAAAAATTCTTCTATCTATCGATTTAAATCAAAGTATGAATTGCC
TTGGTATTTAATAATGGGTGAAAAATTAGAAGGTAAAACTTCTTTTATTGAGTCTTCAGGTTTAAATTTC
CCTATCAATTATGAAGATACTTATCAAAATGAAGAAGACGAAAAATTTAAATGGTATTTTGCTGAACATT
CAATTTTTGTTGATTTACCAGGAAATTATATTCAACAAAAAGATAATCCAGAAGATCCTATCATTTGGAA
ATACTTTTTAAAATTCTTTATAAAAAGGAGATGGAAAAGACCAATAAATGGAATCATTTTAGCTATTAGT
ATAGATACTTTACAAAATAAAAACAATAAAGAGTTAGATAATTTTGCAAAAAATCTAAGAGATAGATTTG
ATGAATTATCTAGTGCTTTTATGTCTAGTATACCTATTTATATTTTGATTACAAAAACTGATAAAGTAGA
AGGATTTGAAAACTATTTTAATAATTTAAATGGTGATGAAAAAGATGAAATATTAGGTGTTACTTTTGAA
GAAGAGAGTTTAAATGATAATAATATAACTCAAGATTTTTCTTCATTATTAAAAAGATTAAATTCTTCTA
TTTTAGATAAGATGCATTTTGAATGGGATTTAGATAACAGAGGTAAGATTTTTTTATTTACTGAAAAAAT
GTCTCAAATTTTGTCAAAAATAAATTATTTTGTAGATACTTGTTTTACTGAAACAAGATATAGAAAACCT
TTGATGTTAAGAGGTGTATATTTTACTTCTATTAAAAAAGATTATGAATCAAGTGGAAAATCAAAAGCTT
TATTTGTTAAAAAACTTCTTGAAAATGTAATTTTTGAAGAATCAGAAATTGGAAAAATTGATGAAAACTA
TAAGAAAAAAGTAAAAAGAAATCAAATAATTTCTTATGTTGCAAGTTTAACTTTTCTTATTTTTTGTGGT
TTTTTTATGATGAATAATTTTATAAATACTAATGAAAAACTTAATGAATTAGAAAATAGCTATAAAGAGT
ATTCTAATCTAAGAAATATAGTTGATTATAAAAGTGAGTTTAAAGATAGTAATAAGTTATTTAATCTAGT
AAATAAAATTCAAAAAGATGAATTTGAATTAAGAAACAACTCTTTTTTTAACTCTTTTATTTTTAAATAT
AAAGATAGAAGTGAAGAATTAAAAAGATTATATTATAGTGATTTATTAAGAATATTATTACCACAAGTTG
CAAATAAAATACAAAATAACATTACTATTAATTTAGATGATTTTTCAAAAACATGGGATAGTACAAAAGC
ATATTTAATGCTAGAGATTTTGGAAAAAAGAGATAAAGATTTTTTAATTACATATATGAGTAATGATTGG
AATCAAACATATTCAAAAGATGAAATATTAAAAAATGACTTATTATCTCATTGGAAGTATCTTTTAAATG
AAGGATTTAATTCCTTTGATACATCTAAACAAGTTATTGAAACAGCAAGAAATAGATTGATTCAATTAAG
TGCAGAAAGATTGACTTATGAAGATTGGAAAAGTAAATTTTCTTATTTGAGCTCGAAAGATTTTTCTTTT
GAAAAAGTTTTGGGAAATAATAGTTCATTATTTATTGGTTCAGATATAAAAATACCAGGGTTATTTACTA
AATTAGGTTATGAAGCTGTTGTTTTAGATGGAAAAAGAGTTTTAAATGATATTTTATTAAATAATTGGGT
TATAGGACAAAAAGTTGATTTAAATGAAAAAGAAAAAGATGAATATTTTGAAAAAATTATGAGTTTTTAT
TTTAATGATTATAAAACTTTTTGGAATGAAGCTTTAATTAATTTGAATATTATATCTTATGATGAAATTG
AAAAATTAAATGAACAATTAGCCATATTAACTTCTAGTGATTCTCCTATTCTTATTATATTGAAACATTT
AAAAGAGAATACAGAACTTTATTCATCTTCTGAAAAAGTAAAAGATACATTAGATATAAATAATCAAACT
ATTTCTGAATTAACATCAAATATTGCATTAAATAAATTAGATAATTTTGATGTGAATAGTGTTTCAATGA
TAAGAGAATTTTTTAAACCATATAATGATTTATTAGATGAAAAATATCAATCAAAAAATCTTTTGAATAC
ATTATTTGAGGAGTTTAATAAAACTTATGAAATTATGAGCAATATAAATGGTTCTGTAAATTTTGAAGAG
GATGCTTTTAAAATAGTTTCAAATAGAGTTCATGGAAAAGTTGCTCCTCTTTTAAATCAACTAAAACTAA
TGCCTCCACAGGTAAAAAAATGGTATGAAGTTGTTATGCAGGGTAATCTAGTATTTATTTCAAAAGGTGC
AAAATCTTATATAAATAAAAAATACAGAAGAATGGTTTTATCTTTTTATAAAGAAAGAATAAAAGGAAAA
TATCCTGCTGATATAACTAATGATGATAATTTTATAAAACTTGATGATTTCAATGAATTTTTTAGAAAAG
ATGGTGTTTTAGATAATTTTTATAAAGAATATATTTCAGGTTTTATCGATATAGATTATGAAAAATCAAC
AGCAAGAGCAAGAAATATTGATGGTAATAAATTGAATTTCTCAAAAGAATTTATTAATAGTTTAATAAAA
GCACAAAATATTAGAAATGTATTTTTTAAGAATGATGGTAGTTTTGGAACGATTTTTAGTATTAAACCTC
ATACTTTAGGTGAAAATTTAGCAACAGCTGAGATAACATTTGATAATACTTCTATTGTTTATGAACATGG
ACCAATTATTATGAAAAAAATAAATTGGCCTAGTGATTCTTTGAATAGTTCTGTAAAACTTAAACTATAT
GATTTAAGTAATAAAATTGTTGTAGAAGATTATATAAATAATGATTGGGCTTTATTTAAATTTATTGACA
AATCAAAAAATTTAACAGTTAAAGATGATTCTTTAATCGTATCTTTTGAAAAATATGATTTTAAAAGTTC
CTTTGAAATAGGTGGTGTTTCTAGATTATATAATAGTGGAAATACTTTATCTTTCTCAATACCAAATAAT
ATATAA
 Primer design