SecReT6
Protein ID: 384217053
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33570
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3431123..3433762 [-]
ProductATP-dependent Clp protease, ATP-binding subunit
NoteTssH
UniProt IDG7DJI2
KEGG IDbju:BJ6T_33570
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.80E-42, Aligned region: 231..249
AAA_2 [PF07724], Evalue: 5.80E-42, Aligned region: 611..777
AAA [PF00004], Evalue: 9.70E-20, Aligned region: 231..331
AAA [PF00004], Evalue: 9.70E-20, Aligned region: 617..735
ClpB_D2-small [PF10431], Evalue: 2.40E-17, Aligned region: 784..860
AAA_5 [PF07728], Evalue: 2.10E-13, Aligned region: 231..251
AAA_5 [PF07728], Evalue: 2.10E-13, Aligned region: 616..734
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 90..145
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 208..253
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 276..309
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 498..525
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 608..661
Sigma54_activat [PF00158], Evalue: 4.00E-08, Aligned region: 213..247
Sigma54_activat [PF00158], Evalue: 4.00E-08, Aligned region: 615..734
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 230..312
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 614..645
AAA_19 [PF13245], Evalue: 5.70E-06, Aligned region: 231..257
AAA_19 [PF13245], Evalue: 5.70E-06, Aligned region: 614..638
Zeta_toxin [PF06414], Evalue: 1.30E-05, Aligned region: 230..254
Zeta_toxin [PF06414], Evalue: 1.30E-05, Aligned region: 609..656
AAA_14 [PF13173], Evalue: 5.40E-05, Aligned region: 231..311
AAA_14 [PF13173], Evalue: 5.40E-05, Aligned region: 615..697
NACHT [PF05729], Evalue: 6.30E-05, Aligned region: 231..257
NACHT [PF05729], Evalue: 6.30E-05, Aligned region: 286..327
NACHT [PF05729], Evalue: 6.30E-05, Aligned region: 424..454
NACHT [PF05729], Evalue: 6.30E-05, Aligned region: 617..644
IstB_IS21 [PF01695], Evalue: 6.50E-05, Aligned region: 213..250
IstB_IS21 [PF01695], Evalue: 6.50E-05, Aligned region: 616..635
Arch_ATPase [PF01637], Evalue: 0.0001, Aligned region: 210..251
Arch_ATPase [PF01637], Evalue: 0.0001, Aligned region: 282..315
Arch_ATPase [PF01637], Evalue: 0.0001, Aligned region: 616..637
AAA_17 [PF13207], Evalue: 0.00018, Aligned region: 231..251
AAA_17 [PF13207], Evalue: 0.00018, Aligned region: 616..652
AAA_25 [PF13481], Evalue: 0.00036, Aligned region: 215..255
AAA_25 [PF13481], Evalue: 0.00036, Aligned region: 284..315
AAA_25 [PF13481], Evalue: 0.00036, Aligned region: 614..638
AAA_18 [PF13238], Evalue: 0.00089, Aligned region: 231..251
AAA_18 [PF13238], Evalue: 0.00089, Aligned region: 618..641
AAA_29 [PF13555], Evalue: 0.0016, Aligned region: 223..246
AAA_29 [PF13555], Evalue: 0.0016, Aligned region: 614..641
NTPase_1 [PF03266], Evalue: 0.0047, Aligned region: 231..253
NTPase_1 [PF03266], Evalue: 0.0047, Aligned region: 283..307
NTPase_1 [PF03266], Evalue: 0.0047, Aligned region: 616..637
RNA_helicase [PF00910], Evalue: 0.0091, Aligned region: 232..252
RNA_helicase [PF00910], Evalue: 0.0091, Aligned region: 617..638
RNA_helicase [PF00910], Evalue: 0.0091, Aligned region: 714..735
Protein Sequence: 879 a.a.     [Download]
>gi|384217053|ref|YP_005608219.1| ATP-dependent Clp protease, ATP-binding subunit [Bradyrhizobium japonicum USDA 6]
MTDISIEAVTGKLNRAGYDAFIQALRHAKSAGNRNVELAHWLFHILQQERNDLSLSVDHYKLDRARLLSD
LAGVINGFRKNETDMPGVANPVIDLLDRGWHYATLFFGETQIRTGHLLVAGLKSNDIRRTLNNLSQEFAK
VNVDALAAERRNVWAGSDEETMRPMDGSGLVGAGTEGAAQAGPKGTTPLDRFSQDLTAKAKSGEMDPILG
RDEEIRQLIDVLMRRRQNNPILTGEAGVGKTAVVEGFAQRIAAGDVPPPLRGVRLCALDIGLMQAGASMK
GEFEQRLRSVIDEVQSSPTPIILFIDEAHTLIGAGGAAGTGDAANLLKPPLARGTLRTIAATTWAEYRQY
IEKDPALTRRFQPIQIDEPEVETCCVMLRGLLGPMEKHHGVRISDAAIVAAVNLSHRYIPSRQLPDKAVS
LLDTASARVAISQSATPALIEDARVAITAREAERSALVSDSDLGIEGDERIVVIDNDIAALKDKLTNLEA
DWAKEQALVKDIRSIREILSEPKEGDDPAARRAELRGKFDTLESINPEKRMVYAHVDQQSVASVVSDWTG
IPVGRMMRDEIETVLKLPEILNRRVVGQSHGLTMIAKRIETSRAKLDNPSKPIGVFMLAGPSGVGKTETA
LALAETLYGGEQNMITINMSEFQEAHTVSTLKGAPPGYVGYGEGGRLTEAVRRKPYSVILLDEVEKAHPD
VHEIFFQVFDKGTMEDGNGRRIDFKNTLIILTTNVGTDLIMGLARDPKYRSEPEELAKMLRPELLKVFPA
ALLGRIVSIPYFPLSDEMLAGIVRLQLDRIGRRLRDNHNASFDYDDAVVEHIVSRCNDPDSGGRMIDNII
TNTLLPELSREFLSKSLAKEEIKKARVSIENDKFAYSWN
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|384213726|ref|NC_017249.1|:c3433762-3431123 Bradyrhizobium japonicum USDA 6, complete genome
GTGACCGACATCAGCATTGAGGCTGTAACGGGCAAGCTGAACCGGGCCGGCTATGATGCCTTCATACAGG
CCCTGCGTCACGCGAAGAGCGCCGGCAATCGCAACGTCGAGCTAGCGCACTGGCTGTTTCATATCCTGCA
GCAGGAACGCAACGATCTCAGCCTCTCGGTCGATCATTACAAGCTCGACCGGGCACGCTTGTTGTCGGAC
CTTGCCGGCGTGATCAATGGCTTTCGTAAGAACGAAACCGACATGCCGGGCGTCGCCAATCCGGTCATCG
ATCTGCTCGATCGGGGCTGGCATTATGCCACGCTGTTCTTTGGCGAAACCCAGATCCGCACCGGTCATCT
GCTTGTGGCGGGCCTGAAATCGAACGATATTCGTCGCACGCTGAACAACCTCTCGCAGGAATTCGCCAAG
GTCAACGTCGACGCACTCGCCGCGGAGCGCCGCAACGTCTGGGCCGGCTCCGACGAGGAAACCATGCGGC
CGATGGACGGTTCGGGCCTGGTCGGTGCAGGCACGGAAGGCGCGGCCCAAGCGGGTCCCAAGGGGACGAC
GCCGCTCGACCGGTTCTCTCAGGATCTCACCGCCAAGGCCAAATCGGGCGAGATGGATCCGATCCTTGGC
CGGGACGAAGAAATCCGCCAGCTGATCGACGTGTTGATGCGACGGCGGCAGAACAATCCAATTCTTACCG
GCGAGGCTGGCGTCGGCAAGACCGCAGTTGTCGAGGGATTCGCCCAGCGAATCGCCGCCGGCGACGTGCC
GCCACCGCTCCGCGGTGTAAGGCTTTGTGCGCTCGATATCGGCCTGATGCAGGCCGGTGCTTCCATGAAG
GGTGAGTTTGAGCAGCGCTTGCGCTCGGTGATCGACGAGGTCCAGAGCTCACCCACCCCCATCATACTGT
TCATCGATGAAGCCCACACATTGATCGGCGCCGGCGGCGCGGCCGGCACCGGTGATGCGGCCAATCTCCT
GAAACCTCCTCTCGCCCGTGGCACGCTGCGCACGATCGCCGCCACCACATGGGCAGAATATCGCCAGTAT
ATCGAGAAAGATCCCGCGCTCACACGACGCTTCCAGCCGATCCAGATCGATGAGCCGGAAGTGGAGACCT
GCTGCGTCATGCTGCGCGGACTTCTCGGTCCGATGGAAAAGCACCACGGGGTTCGCATCTCCGATGCTGC
CATCGTCGCAGCGGTCAACTTGTCCCACCGCTACATTCCTTCACGGCAGCTGCCGGACAAGGCGGTCAGC
CTGCTTGACACCGCCTCGGCACGCGTGGCCATCAGCCAGAGCGCGACGCCAGCCCTGATCGAGGATGCAC
GCGTTGCGATTACCGCTCGTGAAGCGGAGAGATCGGCACTCGTCAGCGACAGTGATCTTGGGATTGAGGG
CGACGAGCGCATCGTAGTGATCGACAACGACATTGCAGCACTGAAGGACAAGCTGACGAACCTCGAAGCC
GATTGGGCCAAAGAGCAGGCGCTCGTCAAGGACATCCGCAGCATTCGAGAGATCCTGTCCGAACCCAAGG
AAGGCGACGATCCGGCTGCCAGGCGCGCGGAGCTGCGCGGCAAGTTCGACACACTTGAGAGCATCAATCC
GGAAAAGCGGATGGTCTATGCCCATGTAGACCAGCAATCGGTGGCGTCCGTTGTTTCTGATTGGACCGGC
ATCCCGGTCGGCCGGATGATGCGCGACGAGATCGAAACCGTGCTGAAACTACCGGAGATCCTCAACCGCC
GCGTCGTCGGCCAGTCTCATGGGCTGACGATGATCGCCAAGCGAATCGAGACCAGCCGCGCCAAACTGGA
CAACCCGTCGAAGCCGATCGGCGTGTTCATGCTGGCTGGTCCATCCGGCGTGGGCAAAACCGAAACCGCG
CTGGCGCTTGCCGAGACCCTTTACGGCGGCGAGCAGAACATGATCACGATCAACATGTCGGAGTTCCAGG
AAGCGCACACCGTCTCGACCTTGAAGGGTGCACCTCCCGGCTATGTCGGCTACGGCGAAGGTGGGCGCCT
CACGGAGGCTGTCCGGCGCAAGCCCTACAGCGTCATCCTGCTCGACGAGGTGGAGAAAGCTCATCCCGAC
GTCCACGAGATCTTCTTCCAGGTGTTCGACAAGGGAACCATGGAAGACGGCAACGGGCGGCGGATCGACT
TCAAGAACACCTTGATCATCCTTACCACCAACGTCGGCACCGATCTGATCATGGGTCTCGCGCGCGATCC
AAAGTATCGCAGCGAGCCGGAAGAGCTCGCCAAGATGCTGAGGCCGGAATTGCTGAAGGTGTTTCCTGCA
GCGCTGCTCGGACGCATCGTCTCGATACCGTACTTCCCGCTATCCGACGAGATGCTCGCCGGGATCGTTC
GGTTGCAGCTCGACCGGATCGGACGACGCCTCCGCGACAATCATAACGCGTCCTTCGACTACGATGACGC
GGTCGTGGAGCACATAGTGTCACGTTGCAACGACCCGGATTCCGGCGGGCGAATGATTGACAACATCATC
ACCAACACCCTGCTCCCGGAGCTGTCGCGCGAGTTCCTTAGCAAATCGCTTGCCAAGGAAGAAATCAAGA
AGGCGCGGGTCTCGATCGAGAACGATAAGTTCGCATATTCGTGGAATTGA
 Primer design