SecReT6
Protein ID: 384217054
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33580
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3433860..3434891 [-]
Producthypothetical protein
NoteTssG
UniProt IDG7DJI3
KEGG IDbju:BJ6T_33580
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.20E-97, Aligned region: 9..309
Protein Sequence: 343 a.a.     [Download]
>gi|384217054|ref|YP_005608220.1| hypothetical protein BJ6T_33580 [Bradyrhizobium japonicum USDA 6]
MTLIDQMKAEPWRFDFFNTLRQLERANSDRPRIGDSAARREEYIDLGQVPYLEFPASNLAAVDDLGGRIR
ILVKFLGLLGPQGALPLATTDESLSWWLMRDDAFPRFLDLLNGRFLQLFFRAWADARPIAQHDRPADDRF
IAYVGSFAGLGSDVLADRDTVPDMAKLSFAGLISPRAKCASRLTRFLQGLFDVKVEIDEFVGTWLSFDPS
HCSRLGGTHASLGRDALLGSRVFSVEDKIRVRVFVKNFTQYEQFLPTEARNLSEPLADAVFFYIGDELEW
EVELAIPAGEVVPVRLGQSGRLGWTTWISPNWTSTEEYRRDARFQLGERLSARRAAAGDAPAI
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|384213726|ref|NC_017249.1|:c3434891-3433860 Bradyrhizobium japonicum USDA 6, complete genome
ATGACGCTGATCGACCAGATGAAGGCGGAGCCCTGGCGGTTCGATTTCTTCAACACGCTGCGCCAGCTCG
AGCGCGCCAACTCCGATCGACCGCGGATCGGTGACAGTGCTGCGCGCCGCGAGGAGTATATCGACCTCGG
CCAAGTGCCTTATCTGGAGTTCCCCGCCTCCAACCTTGCGGCCGTCGACGACCTGGGTGGCCGGATCAGG
ATACTCGTCAAATTTCTCGGTCTCCTGGGGCCGCAGGGCGCGCTGCCGCTTGCCACCACCGACGAAAGCC
TCAGTTGGTGGCTGATGCGGGATGACGCCTTCCCGCGCTTTCTCGATCTGCTCAACGGACGCTTTCTGCA
ACTCTTCTTTCGCGCCTGGGCCGATGCGCGGCCGATCGCTCAGCACGACCGTCCGGCGGATGATCGCTTC
ATCGCCTATGTAGGCTCCTTCGCCGGCCTCGGCTCCGACGTTTTGGCCGATCGAGACACCGTACCGGACA
TGGCGAAGCTCAGCTTTGCCGGACTGATCTCCCCCAGAGCGAAGTGTGCGTCACGGTTGACGCGGTTCCT
GCAGGGGCTGTTCGACGTCAAGGTCGAGATCGACGAATTTGTCGGCACCTGGCTGTCATTCGACCCAAGT
CATTGCAGCCGGCTCGGCGGAACCCATGCCAGTCTCGGCCGGGACGCGCTTCTGGGCTCACGCGTATTCA
GCGTCGAGGACAAGATCAGGGTGCGAGTCTTCGTCAAGAATTTCACCCAGTACGAACAGTTCTTGCCGAC
CGAAGCGCGCAACCTGTCGGAGCCTCTGGCGGACGCCGTATTCTTCTATATCGGCGACGAATTGGAATGG
GAGGTGGAGCTCGCCATTCCGGCGGGAGAGGTCGTTCCGGTCAGGCTCGGACAGAGCGGACGACTTGGAT
GGACCACCTGGATCTCGCCGAACTGGACTTCCACGGAAGAATATCGCCGCGATGCCCGCTTTCAGCTCGG
CGAGCGCTTGAGCGCCCGTCGGGCCGCCGCAGGCGATGCCCCGGCGATTTGA
 Primer design