SecReT6
Protein ID: 384217055
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33590
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3434888..3436855 [-]
Producthypothetical protein
NoteTssF
UniProt IDG7DJI4
KEGG IDbju:BJ6T_33590
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-171, Aligned region: 5..654
Protein Sequence: 655 a.a.     [Download]
>gi|384217055|ref|YP_005608221.1| hypothetical protein BJ6T_33590 [Bradyrhizobium japonicum USDA 6]
MNREFLDFYNRELSLLYEQAGDFAEEYPGIAERLGGLIRDRSDPMITGLLEGAAFLAARVQLKLKHEFPE
FTANLLEQLVPNYLAPTPSAMLVTARPPYADPALRDGRKIARGAYFDAAYRERERSLSCRFRLCRDIVLW
PFDVTGAEYFSTAGALQALGIPVGGDVIAGLRLSLTHRTAARLDEELPDAEARAKPETWFAGCRTSELPI
YLSGAESDAIALYEQLISNCRGVYFRHLDDFGDPVVTRAPHDCVQQIGFDENESLFPNDNRVFRGSELLR
EYFMFPRKFLGFNLTGLRSVIPRLRSKSIDIVFAFDEHNSRLAAAVRPDTFSLYSAPAINLFEKTSDRIP
VKSNTHEYHVVPDRSRYLEYEPHQVLEVYAHFPADKDKRPVRPLYSAAVDRTSGSVEGLYFTVRRLPRRR
TVGEKTYGASSDYTGTDMFLSLLEPGELSGEGAVAELSVRALCSNRHLTEHLPVGQGGADFRLLDDTSLD
LMCVAGPTRPREPIVAQMRSRSEIANSGIVSWRLINMLSLNYLGLVERGGGKNAGALREMLSLFADQFDD
ATERKIRGVRSIESRPVVRRVRERTGSGAARGLEITITLDEKAFEGSGVFLLGAVLERFFADYSGFNTFT
QTVVSTPERGEIMRWPPRMGTRRPL
 
Nucleotide Sequence: 1968 bp     [Download]
>gi|384213726|ref|NC_017249.1|:c3436855-3434888 Bradyrhizobium japonicum USDA 6, complete genome
ATGAACCGCGAATTCCTGGATTTTTACAATCGTGAACTGTCACTGCTCTACGAGCAGGCCGGGGATTTCG
CCGAAGAGTATCCCGGCATCGCAGAACGCCTCGGTGGGCTGATCCGGGATCGCTCAGATCCCATGATCAC
AGGATTGCTGGAAGGCGCCGCATTTCTCGCCGCTCGCGTTCAGCTCAAGCTCAAGCATGAGTTCCCGGAA
TTCACTGCAAACCTGCTCGAGCAACTGGTTCCGAATTACCTTGCCCCGACTCCGTCGGCCATGTTGGTCA
CGGCTCGCCCCCCCTATGCCGACCCAGCGCTACGCGATGGCAGGAAGATCGCGCGCGGCGCCTATTTCGA
TGCCGCCTATCGCGAGAGAGAACGAAGTCTTTCCTGCCGATTTCGACTTTGCCGCGATATCGTTCTTTGG
CCATTTGACGTCACCGGCGCCGAATACTTCTCGACTGCAGGCGCGCTGCAGGCGCTCGGGATTCCCGTCG
GCGGCGACGTCATCGCTGGGCTCAGGCTATCGTTGACCCACCGCACCGCGGCCCGGCTCGATGAGGAGCT
GCCGGACGCAGAGGCTAGGGCCAAGCCGGAAACCTGGTTTGCAGGCTGCCGCACGAGCGAGCTTCCGATC
TACCTTTCAGGCGCGGAATCCGACGCCATTGCGCTTTACGAGCAATTGATCTCGAATTGCAGGGGCGTCT
ACTTCCGGCATCTCGATGATTTCGGCGATCCGGTGGTGACTCGTGCGCCCCATGACTGCGTGCAGCAGAT
TGGTTTCGACGAAAACGAGTCGCTGTTTCCCAACGACAACCGGGTCTTTCGCGGCTCGGAGCTGCTGCGG
GAATATTTCATGTTTCCACGCAAGTTCCTCGGCTTCAACCTGACGGGACTTCGCAGCGTGATACCACGGC
TGCGCAGCAAATCGATCGATATCGTCTTCGCTTTCGATGAACACAATTCACGGCTTGCCGCCGCGGTACG
GCCCGATACTTTCAGTCTCTATAGCGCGCCGGCGATCAACCTGTTCGAGAAGACGAGCGATCGCATCCCC
GTCAAGTCGAATACGCACGAGTACCATGTCGTGCCCGATCGCAGCCGCTATCTGGAATACGAACCGCACC
AGGTGCTCGAAGTCTACGCGCACTTTCCGGCTGACAAGGACAAGCGGCCGGTGCGCCCGCTGTATTCGGC
CGCCGTCGACCGGACCAGCGGATCGGTCGAGGGGCTCTATTTCACCGTTCGACGGTTGCCCCGGCGCCGC
ACAGTGGGAGAAAAGACTTATGGCGCATCCTCGGACTACACCGGGACGGACATGTTCCTGTCTCTGCTGG
AGCCCGGTGAACTAAGCGGCGAAGGTGCGGTCGCCGAACTCAGCGTCCGGGCGCTGTGCTCCAACCGGCA
TCTCACGGAACACTTGCCGGTCGGCCAGGGGGGCGCCGACTTCCGCCTGCTGGACGATACTTCCCTTGAT
CTGATGTGCGTCGCTGGTCCCACCCGACCACGCGAGCCGATCGTGGCGCAGATGCGCAGCCGCAGCGAGA
TCGCGAACAGCGGAATCGTCAGCTGGCGGCTGATCAACATGCTGAGCCTGAACTATCTTGGCCTCGTCGA
GCGCGGTGGCGGCAAGAACGCCGGAGCCCTGCGCGAAATGCTGTCCTTGTTCGCCGACCAGTTCGACGAC
GCCACGGAACGCAAGATCCGCGGCGTGCGCAGCATAGAAAGCCGGCCTGTCGTACGGCGGGTGCGCGAGC
GCACCGGCAGCGGCGCAGCACGCGGCCTGGAGATTACTATCACCCTCGACGAGAAGGCATTCGAGGGCAG
CGGCGTGTTCTTGCTCGGAGCCGTGCTGGAGCGCTTCTTCGCCGACTATTCGGGCTTCAATACCTTCACA
CAGACGGTCGTCTCGACGCCGGAACGCGGCGAGATCATGCGTTGGCCGCCGCGCATGGGCACGCGGAGAC
CTCTATGA
 Primer design