SecReT6
Protein ID: 384217056
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33600
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3436857..3437405 [-]
Producthypothetical protein
NoteTssE
UniProt IDG7DJI5
KEGG IDbju:BJ6T_33600
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.10E-18, Aligned region: 55..161
Protein Sequence: 182 a.a.     [Download]
>gi|384217056|ref|YP_005608222.1| hypothetical protein BJ6T_33600 [Bradyrhizobium japonicum USDA 6]
MTIAPRKDRLSPPLMLAFRSAHEARDARKKLNLRDESGERVIAGRRSAGRFPISETLLRREVSHDLETLL
NTIALESTLDLDGRDCVRTSILNFGFPDIAHRSIDEVADDELTDALRATLTTYEPRLDRNTIRVRRDGSV
GPEQLKLRFIVHADLKAEPLNVPVEFVADVDLDSGDIQINRL
 
Nucleotide Sequence: 549 bp     [Download]
>gi|384213726|ref|NC_017249.1|:c3437405-3436857 Bradyrhizobium japonicum USDA 6, complete genome
ATGACCATTGCACCAAGGAAGGATCGGCTCTCTCCCCCATTGATGCTGGCATTTCGCTCAGCCCATGAAG
CGCGCGACGCACGCAAGAAGCTCAATCTACGCGATGAGTCTGGCGAGCGGGTCATTGCAGGGCGGCGGAG
CGCGGGCCGATTTCCAATCTCGGAAACGTTGCTCCGGCGCGAGGTCTCCCATGACCTCGAAACGCTCCTC
AATACCATTGCCCTGGAATCGACCCTGGATCTGGACGGGCGCGATTGCGTCCGAACCTCAATCCTGAACT
TTGGCTTCCCTGATATTGCCCACCGTTCGATCGATGAGGTCGCCGACGACGAGCTCACCGACGCGTTGCG
CGCGACGCTCACGACTTATGAACCGAGGCTCGATCGCAACACCATCCGGGTCCGACGCGACGGCTCGGTC
GGCCCCGAGCAACTCAAGCTGCGCTTCATCGTTCACGCCGACCTGAAAGCCGAACCGCTCAACGTCCCCG
TGGAATTTGTCGCCGACGTCGACCTCGACAGCGGCGATATCCAGATCAACCGACTTTAG
 Primer design