SecReT6
Protein ID: 384217057
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33610
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3437586..3438071 [-]
Producthypothetical protein
NoteTssD
UniProt IDG7DJI6
KEGG IDbju:BJ6T_33610
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-43, Aligned region: 6..135
Protein Sequence: 161 a.a.     [Download]
>gi|384217057|ref|YP_005608223.1| hypothetical protein BJ6T_33610 [Bradyrhizobium japonicum USDA 6]
MAVDIFLKLDPIKGESLDDKHKDEIDILSWSFGESQTGTFHSGSGGGAGKVSVQDLHFTHFVDKATPELF
KVCANGKHIDSAILTVRKAGENPLEYLKIEMKQVLVTSVSTGGSHGEDRLTENVSLNFAKVKMIYKTQTE
KGGAGASPTFGWDVPANKEWA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|384213726|ref|NC_017249.1|:c3438071-3437586 Bradyrhizobium japonicum USDA 6, complete genome
ATGGCTGTCGACATCTTCCTGAAACTCGATCCGATCAAGGGCGAGTCGCTGGACGACAAGCATAAAGACG
AAATCGATATTTTGAGCTGGTCGTTTGGCGAGAGCCAGACCGGCACCTTCCACAGCGGATCGGGCGGCGG
CGCCGGCAAGGTCAGCGTGCAGGATCTTCACTTCACGCACTTCGTTGACAAGGCCACGCCGGAGCTTTTC
AAGGTCTGCGCAAACGGAAAGCATATTGACAGCGCGATCCTGACGGTCCGCAAGGCCGGCGAAAACCCGC
TGGAATATCTCAAGATCGAGATGAAGCAGGTTCTCGTGACTAGCGTATCAACAGGCGGATCGCACGGCGA
AGATCGGCTTACCGAAAACGTGAGTCTGAACTTCGCAAAGGTCAAGATGATCTACAAGACCCAGACGGAG
AAGGGTGGCGCCGGAGCTTCGCCGACGTTTGGCTGGGATGTTCCTGCCAACAAGGAATGGGCCTGA
 Primer design