SecReT6
Protein ID: 384217058
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33620
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3438120..3439622 [-]
Producthypothetical protein
NoteTssC
UniProt IDG7DJI7
KEGG IDbju:BJ6T_33620
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-183, Aligned region: 67..496
Protein Sequence: 500 a.a.     [Download]
>gi|384217058|ref|YP_005608224.1| hypothetical protein BJ6T_33620 [Bradyrhizobium japonicum USDA 6]
MAKEAVHKESTTQVKTVEADEFATLLKQSFKPRTERAATEVDNAVTTLVQEALKDSSVIKSDVLDTIEEM
IARIDQKLTAQMNEIIHAPEFQAIESTWRGLHYLVFNSETDANLKIRVMNVSKNELYRNLRLYPDARWDQ
SPLFKQIYEYEFGQLGGEPFGCLIGDYYFSHLPTDVQLLRDLSKIAGAAHAPFFSGAEPTLMGMDSWTEL
SNPRDIGKVFDTPEYAAWKGLRDQDDSRYLGLCMPRALGRLPYGAKSEPVEEFAFEEETDGHTGDKYGWI
NAAYAMAVNINRAFKEFGWCTRIRGVQSGGEVINLPTHTFPTDDGGVDLKCPTEIAISDRREHELAKAGL
IPLIHRKNTDKAAFIGAQSLYKPKKYFGEKGVDATASDNLSSRLPYMFAVSRFAHYLKCMVRDKIGSMKE
KDELTVWLQTWINEYVDANPALSSEAQKARKPLAAAKVEVIANEENPGYYNARFFLRPHFQLEAMDVGLS
LVSRLPGPSS
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|384213726|ref|NC_017249.1|:c3439622-3438120 Bradyrhizobium japonicum USDA 6, complete genome
ATGGCAAAAGAAGCTGTTCACAAAGAGAGCACCACCCAGGTCAAGACCGTCGAAGCTGACGAGTTTGCCA
CTCTGCTGAAGCAAAGCTTCAAACCGCGCACCGAGCGCGCAGCGACCGAGGTCGACAACGCGGTAACCAC
GCTCGTTCAAGAGGCATTGAAGGACTCGAGCGTCATCAAGTCGGACGTTCTCGATACCATCGAGGAGATG
ATCGCGCGGATCGACCAGAAGCTGACCGCGCAGATGAACGAGATCATTCACGCGCCCGAATTCCAGGCGA
TCGAAAGTACCTGGCGGGGTCTCCATTACCTCGTCTTCAACTCGGAGACCGACGCCAACCTCAAGATCCG
GGTGATGAACGTCTCGAAGAACGAGCTGTATCGTAACCTGCGGCTTTATCCCGACGCGCGCTGGGACCAG
AGCCCATTGTTCAAGCAGATCTACGAATATGAGTTCGGCCAGTTGGGCGGCGAGCCGTTCGGCTGCCTTA
TCGGCGACTACTATTTCAGCCACCTCCCCACCGACGTGCAGTTGCTGCGCGATCTCAGCAAGATCGCCGG
CGCCGCACACGCCCCCTTCTTCAGCGGCGCCGAGCCGACGCTGATGGGGATGGACTCGTGGACCGAATTG
TCCAACCCTCGCGATATCGGCAAGGTGTTCGACACACCGGAATATGCCGCATGGAAGGGACTGCGCGACC
AGGACGACTCGCGTTATCTCGGCCTGTGCATGCCGCGCGCGCTGGGTCGCCTCCCCTACGGCGCGAAATC
GGAGCCCGTGGAGGAGTTCGCCTTCGAGGAGGAGACAGACGGGCACACCGGCGACAAATACGGCTGGATC
AACGCCGCCTATGCGATGGCGGTCAACATCAACCGCGCCTTCAAAGAGTTCGGCTGGTGCACGCGCATCC
GCGGTGTGCAATCCGGCGGCGAGGTCATCAATCTGCCGACGCACACATTCCCGACCGACGACGGTGGCGT
CGACCTGAAATGCCCGACCGAGATCGCCATCAGCGATCGCCGCGAGCACGAACTTGCAAAAGCGGGCCTC
ATCCCGCTGATCCATCGCAAGAACACCGACAAGGCCGCCTTCATCGGCGCCCAGTCGCTTTACAAGCCGA
AGAAGTATTTCGGCGAGAAGGGCGTGGATGCAACCGCGTCCGACAACCTGTCGTCACGTCTGCCCTACAT
GTTCGCAGTGTCTCGCTTTGCGCACTATCTGAAGTGCATGGTTCGCGACAAAATCGGATCCATGAAGGAG
AAGGATGAGCTGACGGTCTGGCTACAAACCTGGATCAACGAGTACGTTGATGCCAACCCAGCCCTATCGT
CAGAAGCTCAGAAAGCGCGCAAGCCGCTGGCCGCTGCGAAGGTAGAGGTCATAGCAAACGAGGAGAACCC
GGGATATTACAACGCGCGCTTCTTTCTTCGTCCGCACTTTCAATTGGAAGCGATGGATGTCGGCCTCAGT
CTGGTTTCACGCCTGCCAGGTCCCAGCTCCTGA
 Primer design