SecReT6
Protein ID: 384217059
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33630
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3439639..3440115 [-]
Producthypothetical protein
NoteTssB
UniProt IDG7DJI8
KEGG IDbju:BJ6T_33630
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.00E-49, Aligned region: 2..147
Protein Sequence: 158 a.a.     [Download]
>gi|384217059|ref|YP_005608225.1| hypothetical protein BJ6T_33630 [Bradyrhizobium japonicum USDA 6]
MHITYEDPYDAERLIELPFVMGVLSDLSGNNPGVEKTKVEERKFLEFDMDNFDSRMAAIQPGVTARVANR
LSDGSDEKLSVNLRFNKMADFTPVAVARQVPATAKLLEAREQLANLLRYMDGKVAAEDQLKKLLADPQLM
AALRERAISQSTEPGTES
 
Nucleotide Sequence: 477 bp     [Download]
>gi|384213726|ref|NC_017249.1|:c3440115-3439639 Bradyrhizobium japonicum USDA 6, complete genome
GTGCACATCACATACGAAGATCCTTACGACGCCGAGCGGCTGATCGAACTGCCGTTCGTCATGGGCGTCC
TCTCCGACCTTTCCGGCAATAACCCGGGCGTCGAGAAGACCAAGGTCGAGGAGCGCAAATTCCTCGAGTT
TGACATGGACAATTTCGACAGCCGCATGGCGGCAATCCAGCCCGGCGTGACGGCGCGTGTCGCCAATCGT
CTCAGCGACGGATCAGACGAAAAACTTTCGGTCAATCTGCGCTTCAACAAGATGGCCGACTTCACTCCCG
TGGCCGTCGCCCGCCAGGTGCCGGCTACAGCCAAGCTGCTCGAGGCGCGCGAACAACTTGCCAACCTGCT
GCGCTACATGGATGGCAAGGTAGCCGCCGAGGACCAGCTGAAAAAACTTCTGGCCGATCCTCAACTGATG
GCAGCGCTTCGGGAACGCGCGATCAGCCAGTCGACCGAACCTGGCACCGAGAGCTAA
 Primer design