SecReT6
Protein ID: 384217060
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33640
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3440294..3441682 [-]
Producthypothetical protein
NoteTssA
UniProt IDG7DJI9
KEGG IDbju:BJ6T_33640
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 0.0002, Aligned region: 96..146
ImpA-rel_N [PF06812], Evalue: 0.0002, Aligned region: 259..270
Protein Sequence: 462 a.a.     [Download]
>gi|384217060|ref|YP_005608226.1| hypothetical protein BJ6T_33640 [Bradyrhizobium japonicum USDA 6]
MPPARSPSRHGLGSGAVIEQMDGPHMLDVASLTQPIAADDPCGPDLDAIGDVQYLNFFAGAESLLPMSFF
EVVNANGERGRFDPKAVDFAGQFAAAQPILARTRDLRLNLLLAKFSILNRDLDGFLCCLKATNLLLREQW
EAVHPKGEDGDYALRAVTVEAIDVFPTVINPLQFLPLIENRRHGNLNYRAYQIAHGEIPAGDADADGPDL
AAIERIVSETDLDTLKAASGRCSAVAAEIAGIKQTWHEKLNAGQPISLDRLSGLVNGMAAWLAGLVASRD
PAAIAATAEDVGPVDTQAPSDTTGVVTSSAQASAALAAAADYFARMEPSNPALLLVRQAQEMVGKSFIEV
MRMLVPAHVESAAINIGRNKVFDLPIERMAELATSLSSTAENHTQDIVFSVESRAQALGLLAKVASFFRT
AEPSSPVPFLVDRARDLAQRDFLSLLDDVLPEGVLKTIDGSH
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|384213726|ref|NC_017249.1|:c3441682-3440294 Bradyrhizobium japonicum USDA 6, complete genome
ATGCCCCCCGCGCGATCCCCTAGTCGCCACGGGCTCGGCAGCGGGGCCGTGATCGAGCAGATGGACGGCC
CGCATATGCTTGATGTCGCCTCCCTGACGCAGCCCATTGCCGCTGACGATCCCTGCGGGCCGGATCTCGA
CGCCATCGGAGACGTCCAATATCTGAACTTCTTCGCAGGTGCGGAATCGCTGCTACCGATGTCTTTCTTC
GAGGTCGTCAATGCCAACGGAGAGCGTGGACGCTTCGATCCAAAGGCAGTCGATTTTGCCGGCCAGTTTG
CCGCCGCGCAGCCCATTCTGGCGCGTACCCGCGATCTACGTCTGAACCTGCTGCTGGCCAAGTTTTCAAT
CCTCAACCGCGATCTCGACGGCTTTCTCTGCTGCCTGAAGGCGACCAACCTGCTGCTGCGCGAACAGTGG
GAAGCGGTGCATCCGAAGGGCGAGGACGGCGACTACGCACTTCGCGCCGTCACGGTCGAGGCAATCGACG
TGTTCCCGACCGTGATCAACCCGCTCCAGTTCCTTCCCCTGATCGAGAACCGCAGACACGGCAACCTCAA
CTACCGTGCCTATCAAATCGCTCACGGCGAAATTCCCGCCGGCGACGCCGACGCAGACGGGCCTGATCTG
GCAGCCATCGAGCGCATCGTCAGCGAGACAGATCTCGACACTCTCAAGGCAGCCAGCGGGCGGTGCTCTG
CGGTTGCTGCTGAAATCGCGGGTATCAAGCAGACCTGGCACGAGAAGTTGAACGCGGGGCAACCGATCAG
CCTCGACAGGCTCTCCGGCTTGGTTAACGGCATGGCTGCCTGGCTTGCGGGTCTTGTCGCGTCGCGCGAT
CCGGCCGCGATCGCCGCAACCGCGGAAGATGTCGGTCCTGTCGATACACAGGCGCCGTCAGACACGACCG
GGGTGGTGACTTCATCCGCACAGGCATCTGCAGCGCTTGCAGCGGCGGCAGACTATTTTGCCCGAATGGA
ACCATCCAACCCGGCACTGTTGCTGGTGCGTCAAGCGCAGGAGATGGTCGGCAAGTCATTTATCGAAGTC
ATGCGGATGCTGGTGCCTGCGCACGTGGAGAGCGCTGCGATCAACATCGGGCGCAACAAGGTCTTCGACC
TGCCGATCGAACGGATGGCGGAACTCGCCACGTCGCTCTCATCGACGGCCGAGAACCACACTCAAGATAT
TGTATTTTCAGTGGAAAGCAGAGCGCAAGCCTTGGGTCTGCTGGCGAAGGTGGCGTCGTTTTTCCGAACC
GCAGAGCCGTCCAGCCCCGTCCCCTTTTTGGTAGATCGTGCGCGCGACCTCGCGCAACGAGATTTTCTCA
GCCTTTTGGATGATGTTCTTCCTGAGGGAGTCCTTAAAACAATCGACGGATCGCATTGA
 Primer design