SecReT6
Protein ID: 384217061
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33650
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3441957..3443825 [+]
Producthypothetical protein
NoteTssI
UniProt IDG7DJJ0
KEGG IDbju:BJ6T_33650
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.40E-83, Aligned region: 30..333
Phage_base_V [PF04717], Evalue: 8.30E-18, Aligned region: 375..466
Protein Sequence: 622 a.a.     [Download]
>gi|384217061|ref|YP_005608227.1| hypothetical protein BJ6T_33650 [Bradyrhizobium japonicum USDA 6]
MGQLTQDTRLCELKTPLGKDVLVFAGFEGSEGLSELFEYRIECLSEDADLDFDRAIGQQCTLTIKLHEKE
REFSGILTEAQWLGVKNDYFSYRIVLRPWLWLLSRTTDCRIFQDKKAPDIIKEVFNERGFTDYESKLTEE
GSCPKLEYCVQYRETDMNFVCRLMEQHGIYYFFKHEGGKHTLVLADSKSSHSPIKGLATIPYIPLAGADR
RGEQHVYEWVSERRFRTGKIELNDYNYQKPNAQMISDAKGSEHYTRSEMEFYDYPGKFKEKSDGERYAKI
QLQAEQAMDRRRRGNGDAVNLFPGGLTKLEKHSKDSQNVEYLVVRAVHSFSIESYRTGGPSDAGQHVYFG
SYEFLPSDRPFRALMMTPKPRINGVQTAKVVTKDDNSSEEIDVESLGEIYVRFFWDRKKKRSCRLRVAQV
WSGKRWGGQIIPRVGQEVVIEFLEGDPDRPLVIGTVYNDEYKLPYDLPSKKTIAGLKSDSTKGGGGFNEW
SFEDKKGSEKITVHAEKDHDVTVRDTETRTIGEAAFGGDTRSTTLKNGNDKLDIQLGGQHITLAMDQSVN
AGVSITLMANANITLQVGPSQIILTPAGIVINAPTIAMTAQAGMALAAGGPLVAHGTPTLVG
 
Nucleotide Sequence: 1869 bp     [Download]
>gi|384213726|ref|NC_017249.1|:3441957-3443825 Bradyrhizobium japonicum USDA 6, complete genome
ATGGGCCAGCTTACTCAGGATACCCGCCTCTGCGAACTCAAGACGCCTCTTGGCAAGGACGTTTTGGTTT
TTGCCGGATTCGAAGGCTCGGAAGGTCTCAGCGAACTGTTCGAGTATCGCATCGAGTGTCTCAGTGAGGA
TGCCGACCTCGACTTCGACCGCGCTATCGGTCAGCAGTGCACGCTGACCATAAAGCTGCATGAAAAGGAG
CGCGAGTTCAGCGGCATTCTGACGGAGGCCCAATGGCTCGGGGTGAAGAACGACTATTTCAGCTACCGGA
TCGTGCTGAGGCCCTGGTTATGGCTGTTGTCGCGAACCACCGATTGCCGGATCTTTCAGGACAAGAAGGC
ACCCGACATCATCAAAGAGGTCTTCAACGAACGCGGCTTCACCGACTATGAATCCAAACTGACCGAAGAG
GGTTCTTGTCCGAAGCTAGAATATTGCGTTCAGTACCGCGAGACCGACATGAACTTCGTGTGCCGGCTGA
TGGAGCAGCATGGCATCTACTACTTCTTCAAGCATGAGGGCGGCAAGCACACGCTGGTGTTGGCGGACTC
CAAATCGTCGCACAGTCCGATCAAAGGTCTTGCTACGATTCCCTACATCCCGCTCGCGGGTGCCGACCGG
CGAGGCGAGCAGCACGTCTATGAATGGGTATCGGAACGACGATTTCGTACCGGCAAGATCGAACTTAACG
ATTACAATTATCAGAAGCCCAACGCTCAGATGATCAGCGATGCCAAGGGCTCCGAGCATTACACTCGGTC
GGAGATGGAGTTTTACGACTATCCCGGGAAGTTCAAGGAGAAATCCGATGGCGAGCGCTACGCGAAGATC
CAGCTCCAGGCAGAGCAAGCGATGGATCGGCGTCGCCGCGGCAATGGCGACGCCGTCAACCTGTTCCCCG
GTGGGCTGACGAAGCTCGAAAAGCACTCCAAGGACTCGCAGAACGTCGAATACCTCGTGGTGCGAGCTGT
GCACTCGTTCTCGATCGAATCCTATCGCACCGGCGGTCCGAGCGACGCAGGGCAGCACGTCTATTTCGGC
AGCTACGAGTTCTTGCCGAGCGACCGGCCGTTTCGAGCGCTGATGATGACGCCGAAGCCAAGAATCAACG
GTGTCCAGACGGCCAAGGTGGTGACCAAAGACGATAATTCGAGCGAGGAAATCGACGTCGAATCTCTGGG
CGAAATCTATGTCCGCTTTTTCTGGGATCGGAAGAAGAAGCGGTCGTGCCGGTTGCGCGTGGCTCAGGTC
TGGTCTGGCAAGCGCTGGGGCGGTCAGATCATCCCGCGCGTCGGACAGGAAGTCGTTATCGAATTCCTGG
AGGGGGATCCGGACCGGCCCCTGGTGATCGGCACCGTTTACAACGACGAGTACAAGCTGCCCTACGATCT
GCCGTCGAAGAAGACGATTGCAGGATTGAAGTCGGACTCCACCAAAGGTGGCGGCGGCTTCAACGAGTGG
AGCTTCGAGGACAAGAAGGGGTCCGAGAAGATCACGGTGCATGCCGAGAAGGACCACGACGTAACGGTCC
GCGACACCGAGACACGTACCATCGGCGAGGCCGCATTTGGCGGCGACACGCGCAGCACCACGCTCAAGAA
CGGCAATGATAAACTCGATATCCAGTTGGGTGGTCAGCACATCACTTTGGCCATGGACCAGTCTGTCAAT
GCAGGCGTCAGCATCACGCTCATGGCCAATGCCAACATCACCCTACAGGTGGGTCCTAGTCAGATCATTC
TGACCCCGGCGGGCATCGTCATCAACGCGCCGACGATCGCCATGACGGCGCAGGCCGGTATGGCGCTTGC
TGCCGGTGGTCCGCTGGTCGCCCACGGTACTCCAACCCTTGTTGGTTGA
 Primer design