SecReT6
Protein ID: 384217063
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33670
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3444407..3445765 [+]
Producthypothetical protein
NoteFha
UniProt IDG7DJJ2
KEGG IDbju:BJ6T_33670
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.30E-17, Aligned region: 30..96
FHA [PF00498], Evalue: 2.30E-17, Aligned region: 110..127
Protein Sequence: 452 a.a.     [Download]
>gi|384217063|ref|YP_005608229.1| hypothetical protein BJ6T_33670 [Bradyrhizobium japonicum USDA 6]
MVLRFNIENEPNLPDGGPVSFTVTGRRSVDIGRDRHLDWTLPDPARTISGKHCEVHFRDGGYWLHDVSTN
GTFLNGADQRMRGPHRLRDGDRLTIGHYIIGVSLENEAGGRSPNPEPQLREPSVQRHADYGELWAADRDI
PPPIDPQLLKKPREAARPVNPGFLDWAASVPAPGVDPFRRSQPASPHQPSEQDDDMNWAAGPASAPKPQV
ERPPIMPTPRRPSVWTDDEPAAAQPPASPSRPAQAADEGPVTAKPVGGTEFARLVARAAGLPDNFFASRS
DAELAEQLGVILRMTVDNLMALLQARTQAKQLTRSTSQTTVQALENNPLKFSPSSEEAMRILFGPPTRSY
LDAQRAFAQGFSDLKSHQLKTYMAMQHAVHELIAGIDPTLMARELELQRGASSWLGTNKGKLWDEFLTRW
KAHLGRDNSAPIETFMLHFSNYYDRGDKPGSK
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|384213726|ref|NC_017249.1|:3444407-3445765 Bradyrhizobium japonicum USDA 6, complete genome
ATGGTGCTTCGCTTTAATATCGAGAACGAACCGAACCTTCCGGATGGCGGACCTGTGTCGTTTACGGTCA
CCGGCAGGCGTTCAGTCGATATTGGCCGGGACCGTCACCTCGACTGGACGCTGCCGGATCCGGCGCGGAC
GATTTCCGGAAAGCATTGCGAAGTGCACTTTCGCGACGGTGGCTATTGGCTACACGACGTTTCGACCAAC
GGCACCTTCCTCAATGGTGCCGACCAGCGCATGCGGGGGCCGCACCGCTTGCGCGACGGTGACCGACTCA
CGATCGGCCACTACATCATCGGAGTTTCGCTGGAGAACGAGGCTGGCGGACGCAGCCCAAACCCTGAGCC
GCAACTGCGCGAACCCTCGGTCCAGCGGCATGCCGACTACGGAGAGCTTTGGGCAGCCGATCGTGACATT
CCGCCGCCGATCGATCCGCAACTGTTGAAGAAGCCACGCGAGGCTGCGCGGCCCGTCAATCCGGGGTTCC
TGGATTGGGCGGCGAGCGTCCCGGCACCGGGTGTAGACCCGTTCCGACGGTCACAGCCGGCGTCTCCGCA
CCAACCGTCCGAGCAGGACGACGACATGAACTGGGCAGCCGGTCCAGCCAGCGCGCCGAAACCGCAAGTC
GAGCGCCCCCCCATCATGCCGACCCCGCGCCGGCCGTCGGTATGGACCGATGATGAACCAGCCGCTGCCC
AGCCGCCAGCATCGCCATCGCGCCCGGCGCAAGCGGCAGACGAGGGACCTGTCACGGCCAAGCCAGTCGG
CGGTACCGAGTTCGCGCGACTGGTGGCGCGCGCTGCAGGATTGCCGGACAATTTCTTTGCCAGCAGGTCC
GATGCCGAACTCGCCGAACAGCTTGGCGTCATCTTGCGTATGACCGTGGATAATCTGATGGCGCTGCTTC
AGGCGCGGACGCAAGCCAAGCAGCTGACCCGTAGCACCAGCCAAACCACCGTCCAAGCCCTTGAGAATAA
TCCGCTGAAGTTCTCGCCGAGCTCGGAAGAAGCGATGCGCATTCTCTTTGGGCCGCCGACGCGCAGCTAC
CTCGACGCACAGCGCGCCTTTGCACAGGGCTTCAGTGATCTCAAGTCACATCAGTTGAAGACCTACATGG
CGATGCAGCATGCTGTCCATGAGCTGATTGCGGGCATAGATCCGACGCTGATGGCGCGCGAGCTCGAGCT
TCAGCGTGGCGCAAGCTCCTGGCTCGGCACGAACAAGGGAAAACTCTGGGACGAGTTCTTGACGCGCTGG
AAGGCGCATCTCGGCCGCGACAACAGCGCGCCGATCGAAACCTTTATGTTGCATTTCTCGAACTATTACG
ACCGCGGCGACAAGCCCGGTTCAAAGTAA
 Primer design