SecReT6
Protein ID: 384217064
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33680
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3445814..3447151 [+]
Producthypothetical protein
NoteTssK
UniProt IDG7DJJ3
KEGG IDbju:BJ6T_33680
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.00E-131, Aligned region: 19..440
Protein Sequence: 445 a.a.     [Download]
>gi|384217064|ref|YP_005608230.1| hypothetical protein BJ6T_33680 [Bradyrhizobium japonicum USDA 6]
MSWYSKVFWSEGLFLRPHHLQQNDRYIEHLLEKRVRYTTPYPWGFAQLEIDKDLTEQSKFAVRNASGVMP
DGTPFDIPADSQIPEAIDVPETAAGQVVWLMMPVAAPNTREVDEDRTDSASRYVRSSETFIDSTSALRIE
EEIDIAYPRLSFELRKSSKPGYMGLGIARILEVRDKNILFDDKFVPPMLICAAHPIIDGWLNRIIGWVET
KLDELARYAVDPSSGGGLQSVDYLVLQVLNRTIPVLTHFQRSGSVHPERLYEELLRFAGELATFSTAERR
ARNYPAYDHDDLENVFTPLVSDIQDFLSARLGRRAIRLEIIERAQNAFVSPIRDRALFRNATLVLEVAAR
RPLVEIQNDFPHLFKVGPNTKMNEIVHANLPGLTLAHLPTPPPHIRAITDHVYFYLDRKSPLWPEFSTAA
SIGMHFSGDWPELELYLWAILEDRP
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|384213726|ref|NC_017249.1|:3445814-3447151 Bradyrhizobium japonicum USDA 6, complete genome
ATGTCTTGGTACAGCAAAGTTTTCTGGTCGGAAGGTCTATTTCTGCGGCCGCATCATCTGCAGCAGAACG
ACCGCTACATCGAACACTTGCTGGAAAAGCGCGTTCGCTACACGACCCCATACCCGTGGGGCTTTGCCCA
GCTAGAGATCGACAAGGATCTTACCGAACAGAGCAAGTTCGCGGTGCGCAATGCGTCCGGTGTCATGCCG
GACGGTACGCCGTTCGATATCCCCGCGGACAGCCAAATTCCCGAAGCGATCGATGTGCCGGAGACGGCCG
CAGGCCAGGTCGTCTGGCTGATGATGCCGGTCGCGGCGCCAAACACCCGCGAGGTCGACGAGGATCGCAC
CGACAGCGCCAGTCGTTATGTTCGTAGTTCGGAAACCTTCATTGACTCGACCTCTGCGCTACGCATCGAG
GAAGAGATCGACATCGCTTATCCGCGCTTGTCGTTCGAACTGCGCAAGAGCAGCAAGCCCGGATACATGG
GGCTCGGCATCGCGCGCATTCTCGAGGTGCGCGACAAGAACATCCTGTTCGACGATAAGTTCGTGCCGCC
GATGCTGATCTGCGCCGCGCATCCGATCATCGATGGCTGGCTCAACCGCATCATCGGCTGGGTTGAGACT
AAACTCGACGAGCTGGCGCGTTACGCGGTCGATCCGTCATCCGGCGGTGGGTTGCAGAGCGTCGACTATC
TGGTCCTGCAAGTGCTGAACCGTACCATTCCGGTCCTGACTCATTTCCAGCGCTCCGGCAGCGTGCACCC
CGAGCGCCTGTACGAGGAATTGCTGAGATTCGCGGGTGAACTTGCGACGTTTTCTACGGCGGAACGGCGG
GCGCGCAACTATCCGGCTTACGATCACGACGATCTCGAGAACGTCTTCACACCCCTGGTGAGCGACATCC
AGGACTTCTTGAGCGCGCGATTGGGCCGGCGGGCGATCCGCCTTGAGATCATCGAGCGCGCACAGAATGC
GTTCGTATCGCCGATCCGCGATCGAGCGCTATTCCGAAACGCGACCCTGGTGCTGGAGGTTGCCGCGCGG
CGGCCGCTCGTGGAGATCCAGAACGATTTCCCGCACCTGTTCAAGGTCGGGCCGAACACCAAGATGAACG
AGATCGTGCACGCAAACTTGCCGGGCCTGACCTTGGCGCATTTGCCGACGCCGCCGCCGCATATCCGGGC
CATTACGGATCACGTCTATTTCTATCTCGACCGCAAGTCGCCGCTTTGGCCCGAGTTCAGCACGGCGGCC
TCGATCGGAATGCATTTCTCCGGCGACTGGCCGGAGCTTGAGCTGTATCTTTGGGCCATCCTGGAAGACA
GGCCATGA
 Primer design