SecReT6
Protein ID: 384217065
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33690
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3447148..3448674 [+]
Producthypothetical protein
NoteTssL
UniProt IDG7DJJ4
KEGG IDbju:BJ6T_33690
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.30E-55, Aligned region: 116..321
OmpA [PF00691], Evalue: 2.00E-13, Aligned region: 400..498
Protein Sequence: 508 a.a.     [Download]
>gi|384217065|ref|YP_005608231.1| hypothetical protein BJ6T_33690 [Bradyrhizobium japonicum USDA 6]
MSDRDKPVNPFGRGERTIIRPNPGGKLPPAPTSQPPPGEGPAARPGYSPSPVPSPGAPAPPSSFSPVPQG
SNYASAPASHPAEEWISTPAQAQAQQPMLPPGPPLRVDDLVAPNANPVMRAAGPLLQLLGRLRVALMRAS
FASLMEQVADAIKFFEKDIRSAGISEHQANTAKYILCATADDIVQHIPTEERHVWTQYSMLSRFFGERVG
GVRFFEILDHLKVDPLVNYPVLELQHACLALGFQGIHRTSGGGLANLQLIQRNLYELLRRVRPKTMSDLS
PNWRGQALAGRRQRLRVPVWLVAAVVAALLTGSYFVLRTLLAGRSENAAEVALALHPAGPIELKRQIVAP
PPPPPPPPPPDRITQLQRIRNALAKENTACAMTADQTPSFIVIRVCDLALFASGQATILDGFKPIALRVA
ATLDKEPGRIRVVGHTDSSPIRTVRFPSNFELSVERAKAVAAALKPGLTDGARVDVEGKGADAPIASNTT
PEGRAKNRRVEIFIERSE
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|384213726|ref|NC_017249.1|:3447148-3448674 Bradyrhizobium japonicum USDA 6, complete genome
ATGAGCGACAGGGACAAGCCGGTCAATCCTTTCGGTCGGGGCGAACGGACGATCATTCGTCCCAACCCCG
GCGGGAAGTTGCCGCCGGCGCCGACCTCTCAGCCTCCGCCGGGCGAGGGGCCCGCGGCACGCCCAGGCTA
TTCGCCATCACCAGTACCCTCTCCCGGCGCGCCGGCGCCACCGTCATCATTTTCTCCTGTCCCGCAGGGC
TCGAACTACGCCTCCGCGCCGGCCAGCCATCCCGCTGAGGAATGGATATCGACACCCGCACAGGCCCAGG
CGCAGCAGCCTATGCTACCGCCAGGACCGCCGCTGCGCGTCGACGATCTCGTCGCGCCAAATGCCAATCC
AGTGATGCGTGCTGCGGGCCCGTTGCTGCAGCTGCTTGGTCGGTTGCGGGTGGCGCTCATGCGCGCGTCA
TTCGCGAGTTTGATGGAGCAGGTTGCAGACGCGATCAAGTTCTTCGAGAAGGACATCCGTTCCGCGGGCA
TATCCGAGCACCAGGCCAACACAGCGAAATACATCCTGTGTGCCACTGCCGACGATATCGTGCAGCACAT
CCCAACCGAGGAGCGCCACGTCTGGACGCAATATTCGATGCTGAGCCGGTTCTTCGGCGAGCGTGTCGGC
GGCGTCCGTTTCTTCGAGATCCTCGACCATTTGAAGGTTGATCCACTGGTCAACTATCCGGTCCTCGAAC
TCCAGCACGCCTGCCTTGCGCTTGGTTTTCAGGGCATTCACCGGACGTCAGGTGGCGGACTTGCGAACCT
GCAGCTGATCCAGCGTAACCTTTATGAATTGCTGCGCCGGGTCCGGCCGAAGACGATGAGCGACCTGTCG
CCCAACTGGCGCGGGCAGGCGCTGGCGGGGCGCCGGCAGCGTCTGCGCGTTCCGGTCTGGCTCGTCGCGG
CCGTCGTCGCCGCGCTGCTGACCGGGTCCTATTTCGTCCTGCGGACGCTCCTCGCTGGCCGGTCAGAGAA
TGCTGCCGAGGTGGCGCTCGCGCTCCATCCAGCCGGCCCGATCGAGCTCAAGCGCCAGATCGTTGCACCA
CCGCCGCCGCCTCCACCTCCGCCGCCACCGGATCGCATCACCCAGTTGCAACGCATCCGCAATGCGCTCG
CGAAGGAGAACACCGCCTGTGCCATGACGGCGGACCAGACCCCGAGCTTCATCGTGATCAGGGTCTGCGA
TCTGGCGCTGTTCGCGTCGGGCCAGGCGACCATCCTCGACGGTTTCAAGCCGATCGCACTCCGCGTCGCA
GCAACCCTCGACAAGGAGCCGGGACGGATTCGGGTCGTCGGCCATACCGACAGTTCGCCGATCCGCACAG
TCCGCTTCCCGTCAAATTTCGAGTTGTCGGTCGAGCGTGCCAAGGCGGTAGCCGCGGCATTGAAGCCTGG
CTTGACCGATGGCGCACGCGTCGACGTCGAGGGCAAAGGAGCAGATGCGCCAATCGCCAGCAACACGACA
CCCGAGGGACGCGCCAAGAACCGGCGCGTCGAGATCTTTATCGAACGCAGCGAATAG
 Primer design