SecReT6
Protein ID: 384217066
SecReT6 ID587
T6SS typei3
Gene symbol-
Locus tagBJ6T_33700
StrainBradyrhizobium japonicum USDA 6
Repliconchromosome [GenBank: NC_017249] [Browse all T6SS(s) in this replicon]
Location [Strand]3448718..3452254 [+]
Producthypothetical protein
NoteTssM
UniProt IDG7DJJ5
KEGG IDbju:BJ6T_33700
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.60E-86, Aligned region: 181..439
IcmF-related [PF06761], Evalue: 7.40E-84, Aligned region: 494..804
IcmF-related [PF06761], Evalue: 7.40E-84, Aligned region: 882..918
DUF1215 [PF06744], Evalue: 2.30E-35, Aligned region: 697..739
DUF1215 [PF06744], Evalue: 2.30E-35, Aligned region: 897..1021
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 117..134
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 168..198
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 397..422
AAA_19 [PF13245], Evalue: 0.0087, Aligned region: 118..134
AAA_19 [PF13245], Evalue: 0.0087, Aligned region: 398..429
Protein Sequence: 1178 a.a.     [Download]
>gi|384217066|ref|YP_005608232.1| hypothetical protein BJ6T_33700 [Bradyrhizobium japonicum USDA 6]
MLAKDILRIVLYGVGLSSLGAVIYLAGPFIAFGDWRPLENHIVRQIAILLLTTVVAGIVGLNLFKRRKSA
KEIADGIAGADQPVSDEPVLKERMKDALATLKTASGNKSGYLYDLPWYVIIGPPGAGKTTALVNSGLKFP
LARGATPAAIAGVGGTRYCDWWFTEEAVLIDTAGRYTTQDSNSKADKDSWLAFLDILKKSRSRQPINGVL
VAISIEDILTLPKQELALHADAIRMRLLELHQRLKVSFPVYALFTKADLVAGFTEYFAYLGEAGRRQVWG
ATFQTADKTQNLVGQIPVEFDRLLERLSEETLDRLQDEPTPQHRVQLFGFPAQMARLKPQIHDFLNQIFE
PTRYHVNANLRGFYFTSGTQQGTPIDQLIGSLARTFGAEEVGSGSYSGAGKSFFLADLISKVIIGEADWV
STDRAAVRRALILKTAGLSLIGLVSIGLIAAWLMSYKRNSDLIEQSLQADSEYAAAGAPLIKQTLIADHD
LDKVLPLLYRLRNAPAGYGSRAQSVPLSARYGLSQHARLLSPSKAAYHTALERMFRPRLLYRLEEQLNAR
INEPAFVYEALKVYLMVGGLQSPDRELIRSWMQRDWVDNLYPGATNAEGRRLLDENLVAMFDLETEQQPL
VELDGRLIKQAQSSLARLSVSQRAYEFLKSEARASTAGDWIASRHGGPDMGVVFETTTGQPLDAVRVPEF
FTYNGFHQKFVARLSGLSERMKRERWVLGDAGQQSAIDQQYDNLAGDLLNIYSNDFVTTWRTALGSLRLK
KLLADKPKYEVLRALSAPTSPMRQILESVRDETVLTKERAKPANASAQAAAPAPALFTNAQDGPPGATIE
AQFKPYHAALEGESTRRPIDSTVANLNDIAQNLTLIIENPQLTAQATAALQAQVAALRNNASRMPPPFSD
MLRAAAAEFEGSIAASTAGQILQTLRDQVTPVCQQTVTNRYPFVRSSGQEVPLADFAKLFSPNGVMDKFF
TQYLAPYADTSRSDWAWRKESPVGRSFSPDTLKQFQNAAYIRDAFFQTGGGVPAVSFAIRPPGAPGPGVT
VKTEIGGTTIASPTIPGPATSSLFGGPQPTPPPPPQSNSPTTVLWPGPAPRTAISVSNDTGAPSVLERIG
PWSLFRMLEAGSLVVKAETASATFIVAGRELNYQISTGSLRNPLNLSVLREFRCPTGI
 
Nucleotide Sequence: 3537 bp     [Download]
>gi|384213726|ref|NC_017249.1|:3448718-3452254 Bradyrhizobium japonicum USDA 6, complete genome
ATGCTTGCCAAGGACATTCTTCGCATCGTTCTCTACGGAGTAGGGCTCAGCTCGCTCGGAGCGGTGATCT
ATCTCGCCGGTCCCTTCATCGCGTTCGGCGACTGGCGGCCGCTGGAGAACCATATCGTCCGGCAGATCGC
TATTCTGCTGCTCACCACGGTCGTGGCAGGCATCGTTGGCCTCAATCTATTCAAGCGTCGCAAGAGTGCC
AAGGAGATTGCCGATGGCATCGCTGGTGCGGACCAGCCTGTCAGCGATGAACCGGTGCTCAAGGAGCGCA
TGAAGGATGCGCTCGCGACGCTGAAGACCGCCAGCGGCAACAAGTCGGGCTATCTCTACGATCTGCCGTG
GTACGTCATCATCGGTCCGCCCGGCGCCGGCAAGACCACGGCGCTGGTCAATTCCGGGCTCAAATTTCCG
CTCGCGCGCGGGGCGACGCCCGCAGCGATCGCGGGAGTCGGTGGTACGCGCTACTGCGATTGGTGGTTTA
CCGAGGAGGCGGTGCTGATCGATACCGCCGGCCGCTACACGACCCAGGACTCCAACAGCAAGGCCGACAA
GGACAGCTGGCTGGCGTTCCTGGACATCCTGAAGAAAAGCCGGTCGCGCCAGCCGATCAACGGCGTCCTC
GTCGCCATCAGTATCGAAGACATCCTGACGCTGCCGAAGCAGGAACTCGCACTTCACGCCGATGCCATCA
GGATGCGCCTGCTCGAGTTGCATCAGAGGCTCAAGGTCAGCTTCCCGGTCTACGCGCTATTTACCAAAGC
CGATCTCGTTGCCGGCTTCACCGAGTATTTCGCCTATCTCGGGGAGGCCGGCCGGCGCCAGGTCTGGGGT
GCCACGTTCCAGACCGCAGACAAGACCCAGAATCTGGTGGGGCAGATCCCGGTCGAGTTCGACCGTCTGC
TGGAGCGCCTGAGCGAGGAGACGCTCGACCGTCTGCAGGATGAGCCGACGCCCCAGCACCGCGTGCAATT
GTTCGGCTTTCCGGCACAGATGGCGCGGCTCAAGCCTCAGATCCACGACTTCCTCAACCAGATCTTCGAG
CCGACGCGCTATCACGTGAACGCGAACCTGCGCGGTTTCTACTTCACCTCGGGCACGCAGCAGGGCACGC
CGATCGACCAATTGATCGGGTCGCTGGCACGTACGTTCGGCGCTGAGGAGGTCGGTTCCGGATCCTATTC
GGGCGCGGGCAAGAGCTTCTTCCTCGCCGATCTGATTTCCAAGGTCATCATAGGCGAGGCCGACTGGGTG
TCGACCGACCGTGCCGCGGTGCGCCGCGCGCTGATCCTGAAAACCGCGGGCCTGTCTTTGATCGGCCTGG
TCTCGATCGGACTGATCGCAGCTTGGCTGATGAGCTACAAGCGGAACTCCGATTTGATCGAGCAAAGCCT
GCAGGCGGATAGCGAGTATGCAGCCGCCGGCGCACCACTTATCAAGCAGACGCTAATTGCCGATCATGAT
CTCGACAAGGTGCTGCCGCTACTCTACCGGTTGCGCAACGCCCCGGCAGGGTACGGATCGCGCGCCCAGT
CGGTGCCTCTGTCGGCTCGCTACGGGCTCAGTCAGCACGCCCGGCTGCTGTCGCCCTCGAAGGCGGCCTA
TCATACGGCGCTTGAGCGCATGTTTCGGCCGCGCCTGCTGTATCGCCTCGAGGAGCAGCTCAATGCGCGC
ATCAACGAACCTGCCTTCGTCTACGAGGCGCTCAAGGTCTACTTGATGGTCGGCGGCCTACAGTCGCCAG
ACCGCGAGCTGATCCGCTCCTGGATGCAACGTGACTGGGTGGACAACCTCTATCCTGGCGCCACCAACGC
GGAAGGGCGGCGTCTGCTCGACGAGAATCTCGTGGCAATGTTCGACCTCGAGACCGAGCAGCAGCCGCTG
GTCGAACTCGACGGCCGGCTGATCAAGCAGGCCCAGAGCTCCTTGGCGCGCCTGAGCGTGTCGCAACGTG
CCTACGAGTTTCTGAAATCGGAGGCTCGCGCATCGACCGCTGGCGACTGGATCGCTAGCCGCCATGGCGG
ACCCGACATGGGTGTCGTGTTCGAAACCACGACGGGGCAGCCTTTGGACGCGGTGCGGGTACCTGAGTTC
TTCACGTATAACGGCTTCCATCAGAAGTTCGTCGCCCGGCTGTCCGGATTGTCTGAGCGGATGAAGAGGG
AGCGATGGGTTTTGGGTGACGCAGGCCAGCAGTCAGCCATCGACCAGCAGTACGACAATCTGGCCGGCGA
TCTGCTCAACATCTATTCGAACGATTTCGTGACGACCTGGCGAACGGCGCTCGGGAGCCTGCGCCTGAAG
AAGCTGCTCGCCGACAAGCCGAAATACGAGGTGCTGCGGGCGCTTTCGGCGCCGACCTCGCCGATGCGGC
AAATTCTGGAATCGGTGCGCGACGAGACGGTGCTGACCAAGGAACGGGCGAAGCCGGCGAACGCTTCGGC
GCAAGCTGCCGCACCGGCGCCCGCACTCTTCACGAACGCCCAGGATGGACCGCCTGGCGCGACGATCGAG
GCACAGTTCAAACCTTACCACGCGGCGCTCGAAGGCGAGAGCACCCGCCGGCCGATCGACTCGACGGTCG
CAAACCTGAACGACATCGCGCAGAACCTGACGTTGATCATTGAGAATCCCCAACTGACAGCACAGGCCAC
GGCTGCGCTTCAGGCCCAGGTCGCAGCGCTCCGCAACAATGCCTCGCGCATGCCGCCGCCATTCTCCGAC
ATGCTGCGCGCAGCAGCCGCGGAGTTCGAAGGCAGCATCGCGGCTTCAACCGCCGGGCAAATCCTGCAAA
CGTTGCGCGATCAGGTCACGCCGGTCTGCCAACAGACCGTGACCAACCGCTACCCGTTTGTCCGCAGCAG
CGGCCAGGAAGTCCCGCTGGCGGATTTTGCCAAATTGTTCAGTCCGAATGGCGTTATGGACAAGTTCTTC
ACCCAGTACCTGGCACCTTATGCCGATACGTCGCGGTCGGACTGGGCTTGGCGCAAGGAGAGCCCCGTTG
GTCGGTCGTTCTCGCCCGACACGCTCAAACAATTCCAGAATGCGGCTTATATCCGGGATGCGTTCTTCCA
GACGGGCGGCGGTGTGCCCGCCGTTTCTTTCGCGATCCGGCCTCCTGGGGCACCGGGCCCAGGCGTGACC
GTTAAGACCGAGATCGGCGGCACCACGATTGCGAGTCCAACCATTCCCGGACCGGCCACGTCGTCCTTGT
TCGGCGGTCCGCAACCGACGCCACCGCCACCGCCACAGAGCAACTCGCCAACGACCGTCCTATGGCCGGG
CCCGGCGCCCCGAACGGCAATCTCAGTTAGTAACGACACCGGCGCGCCATCCGTGCTTGAGCGCATTGGT
CCCTGGTCGCTATTTCGGATGCTGGAGGCGGGCTCGTTGGTTGTGAAAGCGGAAACGGCCAGCGCGACTT
TCATCGTCGCGGGGCGCGAGCTCAACTATCAAATTTCGACTGGGTCGTTGCGCAACCCGCTAAACCTGTC
AGTGCTGCGCGAGTTTCGTTGCCCGACCGGGATATGA
 Primer design