SecReT6
Protein ID: 384413992
SecReT6 ID590
T6SS typei3
Gene symbol-
Locus tagYPC_1444
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]1414132..1415814 [-]
Productputative OMPA family outer membrane porinprecursor
NoteTagL
UniProt IDE8P3U6, E8P3U6
KEGG IDyph:YPC_1444
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.10E-18, Aligned region: 191..217
OmpA [PF00691], Evalue: 5.10E-18, Aligned region: 441..539
Protein Sequence: 560 a.a.     [Download]
>gi|384413992|ref|YP_005623354.1| putative OMPA family outer membrane porinprecursor [Yersinia pestis biovar Medievalis str. Harbin 35]
MFKVKLNKTLSLLWLAAVGALLVSVNFKGNALWNNVIFITFLALMVLAIWKHYALKPKHPQVSTPIPQET
AEPVEQESTVILILGPYAEKWFSNPESPDSTRFSSHAVWILITNPAALQKRLTYIAEHHPSARVLTFFPF
LPDVYENAAVMMSKLTVWQNTFSTLSLRSPLPCVFAIYAQLSNERLSHNSDNAYWTGNINLANQQPIEIT
QALQSLSQRLELQDINHSRFATQRNVMAHNLFTWLNESGVTNLLQSIFSRTPLRLTDVILSDNGKGFIRH
GAWSAWLEKKFGIIPSLASTLSLPPFPAVINDQKPAMKPRVKTPVIKPTPASRGWLWSVCFAAVLLASHM
LNTLWQEKNRHEQFNQQMVPLDNISDFSAQYLARSITQLTDEGKILTTCVNTFDVTRWGLSQCKTLLSQI
NRRIESYENIPVFSFAQKLPLFDSNSTKLKLNSQTNEMMMELLSLVERNKEKKILIVGHSDNTGSSSMNM
ALSEQRALALRDWLIKRSDITVDNFITKGMGASEPVATNHTEAGREQNRRVEVLILPTQDRTRMTEPKPL
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c1415814-1414132 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGTTTAAGGTTAAATTGAATAAAACGCTCTCTCTATTATGGCTGGCTGCGGTCGGCGCCCTATTGGTGA
GTGTGAATTTTAAGGGAAATGCGTTATGGAATAACGTTATTTTCATTACTTTCCTGGCGCTGATGGTTCT
TGCCATCTGGAAACATTACGCCCTCAAACCCAAACACCCCCAAGTGTCGACTCCCATTCCGCAGGAGACA
GCGGAACCTGTAGAACAGGAGAGTACGGTTATTTTAATTCTCGGTCCCTATGCTGAGAAATGGTTTAGTA
ACCCAGAATCGCCAGACAGTACACGTTTTTCCAGCCATGCGGTTTGGATATTAATCACGAATCCCGCCGC
GCTGCAAAAACGCCTCACATATATTGCTGAACATCATCCATCCGCTCGGGTATTGACCTTTTTCCCTTTC
TTGCCGGATGTCTATGAGAATGCAGCAGTGATGATGTCAAAACTCACTGTGTGGCAGAACACTTTTTCAA
CGTTATCACTGCGATCCCCCCTCCCCTGCGTATTTGCTATTTACGCGCAGTTGAGTAATGAACGCCTTAG
CCATAATTCTGATAACGCATATTGGACTGGAAATATTAATCTTGCGAACCAGCAGCCTATCGAGATTACG
CAAGCCCTACAGTCACTGAGCCAACGACTTGAGTTACAAGACATCAATCACTCAAGATTTGCAACTCAGC
GTAATGTTATGGCGCATAATTTATTTACTTGGTTGAATGAATCGGGGGTGACAAACCTTCTGCAATCTAT
TTTCTCTCGCACCCCCTTACGGCTAACAGATGTCATTTTGTCGGATAATGGCAAAGGGTTCATCAGGCAT
GGTGCCTGGTCAGCCTGGCTGGAAAAAAAGTTTGGCATCATACCAAGCTTAGCCTCAACCTTGTCACTGC
CACCTTTCCCAGCGGTGATCAATGACCAGAAGCCCGCAATGAAACCACGGGTGAAAACACCGGTGATAAA
ACCTACCCCCGCATCCCGCGGGTGGTTATGGAGTGTATGCTTCGCCGCGGTGCTATTAGCCTCACATATG
CTAAACACCCTGTGGCAAGAAAAAAACCGGCATGAGCAATTTAACCAACAGATGGTGCCGTTGGACAATA
TCAGCGATTTTTCTGCTCAGTACCTGGCACGCAGCATCACCCAGTTAACTGATGAAGGTAAAATATTAAC
CACATGCGTTAATACATTTGATGTCACACGTTGGGGGCTGTCTCAATGCAAGACGTTATTAAGCCAAATC
AACCGCCGGATTGAATCCTATGAAAATATTCCTGTTTTCAGTTTTGCCCAAAAGCTCCCTCTGTTTGACT
CAAACAGTACCAAGCTGAAACTGAACTCACAAACTAATGAAATGATGATGGAGTTGTTATCACTGGTCGA
ACGGAATAAAGAGAAAAAAATCTTAATTGTTGGCCATTCTGATAACACAGGCAGTTCCTCCATGAACATG
GCACTTTCCGAACAGCGTGCGCTGGCCCTTCGCGATTGGTTAATTAAACGCAGTGATATCACTGTCGATA
ATTTTATTACCAAGGGAATGGGGGCTTCAGAACCGGTTGCGACCAATCACACGGAAGCGGGTCGAGAACA
AAACAGACGCGTCGAAGTACTGATATTACCCACACAAGATAGAACAAGAATGACGGAGCCTAAACCTTTA
TGA
 Primer design