SecReT6
Protein ID: 384413997
SecReT6 ID590
T6SS typei3
Gene symbol-
Locus tagYPC_1449
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]1420208..1421233 [-]
Producthypothetical protein
NoteTssG
UniProt IDE8P3V1
KEGG IDyph:YPC_1449
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-88, Aligned region: 22..321
Protein Sequence: 341 a.a.     [Download]
>gi|384413997|ref|YP_005623359.1| hypothetical protein YPC_1449 [Yersinia pestis biovar Medievalis str. Harbin 35]
MLPDESVHQEKHANLDAWYQESQPWNAGFISMMRANAARNPTLPAPGKAPLPEQEAFRIGQSAHMTFSPR
EISHAVMRDGKMDLQLFGLGIWGPNGAMPLQMTELAYTRAELHDHTMTDFVDLFHHRALSQLYRAWFVSQ
DTASLDRQSDEKFSFYVGSLAGLDPQELNDTELPVHARLASSAHLIREARNPEGLVGALQYYFDVPVRMV
EYAEQWIFLEESDQTQLGDGAGAMLLGDGAILGNTVLDRQHKFQLILGPLSLQQYLRFSLWGQDLPVLRE
WVRNFVGFEYAWEVQLLLSADEVPMATLDGGHQLGYTSWLARSDTTLDVGGMSFEPEMHHD
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|384412706|ref|NC_017265.1|:c1421233-1420208 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGTTACCCGATGAATCCGTTCACCAGGAAAAACATGCCAATCTGGACGCCTGGTATCAGGAGTCTCAGC
CATGGAACGCCGGTTTTATCAGCATGATGCGGGCGAATGCCGCCCGCAACCCTACCCTGCCAGCGCCAGG
AAAAGCGCCCTTGCCTGAACAGGAAGCCTTCCGCATCGGGCAAAGTGCGCACATGACGTTCTCTCCGCGT
GAGATATCTCACGCGGTCATGAGAGACGGGAAAATGGATCTGCAACTTTTTGGCTTAGGGATTTGGGGGC
CAAATGGTGCGATGCCGCTTCAGATGACCGAACTGGCCTATACCCGTGCCGAGTTGCATGATCATACGAT
GACGGATTTCGTCGACCTTTTTCATCACCGCGCATTATCACAGCTTTATCGGGCGTGGTTTGTCTCTCAG
GATACCGCCTCGCTAGATCGGCAGAGTGATGAAAAATTCTCCTTCTATGTCGGTAGTCTCGCCGGGCTGG
ATCCTCAAGAACTTAATGATACCGAACTCCCGGTTCATGCCCGGTTAGCCTCCTCTGCCCATTTGATTCG
TGAAGCGCGCAACCCCGAAGGGCTCGTGGGCGCATTGCAGTACTACTTTGACGTCCCCGTGCGGATGGTG
GAGTACGCCGAGCAGTGGATCTTTCTGGAAGAAAGCGACCAGACACAATTGGGTGATGGTGCAGGCGCGA
TGCTCTTGGGCGACGGTGCTATTTTGGGCAATACCGTTTTGGATCGGCAGCATAAATTTCAACTGATCCT
CGGCCCCCTCAGCCTGCAACAGTACCTGCGCTTTAGCCTCTGGGGACAAGACTTACCGGTATTGCGAGAG
TGGGTACGTAACTTTGTTGGGTTCGAATACGCCTGGGAAGTCCAGTTGTTGTTAAGCGCCGATGAGGTTC
CCATGGCAACACTCGATGGCGGACATCAATTGGGATACACCTCTTGGTTAGCCCGCAGTGATACCACCCT
TGATGTCGGTGGGATGAGTTTTGAGCCTGAAATGCATCACGATTAA
 Primer design