SecReT6
Protein ID: 384414000
SecReT6 ID590
T6SS typei3
Gene symbol-
Locus tagYPC_1452
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]1423821..1426571 [+]
ProductClpB protein
NoteTssH
UniProt IDE8P3V4
KEGG IDyph:YPC_1452
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 256..336
AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 644..810
AAA [PF00004], Evalue: 4.30E-21, Aligned region: 258..389
AAA [PF00004], Evalue: 4.30E-21, Aligned region: 649..766
ClpB_D2-small [PF10431], Evalue: 1.90E-16, Aligned region: 816..894
AAA_5 [PF07728], Evalue: 4.00E-13, Aligned region: 258..336
AAA_5 [PF07728], Evalue: 4.00E-13, Aligned region: 648..766
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 236..276
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 296..336
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 523..542
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 646..684
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 713..736
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 812..836
Sigma54_activat [PF00158], Evalue: 2.30E-07, Aligned region: 253..337
Sigma54_activat [PF00158], Evalue: 2.30E-07, Aligned region: 648..747
AAA_22 [PF13401], Evalue: 5.60E-07, Aligned region: 258..344
AAA_22 [PF13401], Evalue: 5.60E-07, Aligned region: 391..424
AAA_22 [PF13401], Evalue: 5.60E-07, Aligned region: 646..668
AAA_22 [PF13401], Evalue: 5.60E-07, Aligned region: 710..735
AAA_14 [PF13173], Evalue: 4.00E-06, Aligned region: 258..339
AAA_14 [PF13173], Evalue: 4.00E-06, Aligned region: 647..730
AAA_25 [PF13481], Evalue: 5.90E-06, Aligned region: 258..282
AAA_25 [PF13481], Evalue: 5.90E-06, Aligned region: 646..673
AAA_19 [PF13245], Evalue: 2.00E-05, Aligned region: 256..281
AAA_19 [PF13245], Evalue: 2.00E-05, Aligned region: 646..670
IstB_IS21 [PF01695], Evalue: 4.10E-05, Aligned region: 252..277
IstB_IS21 [PF01695], Evalue: 4.10E-05, Aligned region: 648..668
Zeta_toxin [PF06414], Evalue: 5.60E-05, Aligned region: 258..278
Zeta_toxin [PF06414], Evalue: 5.60E-05, Aligned region: 641..688
Clp_N [PF02861], Evalue: 6.60E-05, Aligned region: 50..99
Clp_N [PF02861], Evalue: 6.60E-05, Aligned region: 138..147
AAA_29 [PF13555], Evalue: 7.60E-05, Aligned region: 248..278
AAA_29 [PF13555], Evalue: 7.60E-05, Aligned region: 646..673
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 258..289
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 648..675
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 237..271
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 311..408
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 647..693
AAA_17 [PF13207], Evalue: 0.00048, Aligned region: 88..134
AAA_17 [PF13207], Evalue: 0.00048, Aligned region: 259..277
AAA_17 [PF13207], Evalue: 0.00048, Aligned region: 402..431
AAA_17 [PF13207], Evalue: 0.00048, Aligned region: 648..683
AAA_18 [PF13238], Evalue: 0.0034, Aligned region: 258..277
AAA_18 [PF13238], Evalue: 0.0034, Aligned region: 650..674
AAA_23 [PF13476], Evalue: 0.0073, Aligned region: 258..278
AAA_23 [PF13476], Evalue: 0.0073, Aligned region: 495..567
AAA_23 [PF13476], Evalue: 0.0073, Aligned region: 646..671
UPF0079 [PF02367], Evalue: 0.0082, Aligned region: 258..278
UPF0079 [PF02367], Evalue: 0.0082, Aligned region: 646..675
Protein Sequence: 916 a.a.     [Download]
>gi|384414000|ref|YP_005623362.1| ClpB protein [Yersinia pestis biovar Medievalis str. Harbin 35]
MVHQALFHEQFKLHMNAVKKTRIKNVAITRKHLFGKLDATLFKGIESATTICKLRGNPYVELVHWLNQLW
HQEDNDLKQIIRYFAVDVDAFERELAQALAKLPVGATSISDFSYHIELATERAWIYASLECLDTRIRSGH
LLLALLTTMELRRAFFAIAPSMEKIPLEHLSKDLNFITQASPEANEAASDGSPLYDGALPGEASNAIGAA
KSGGALAQYTTDLTALAREGKIDPVLGRNHEINTMVDILLRRRQNNPLLTGDAGVGKTAIVEGLALAIAA
GSMPPALSQVSLLSLDIVALSAGASMKGEFEARLKSVLDEAIAAEKPVILFIDEVHTLIGAGGNAGTGDA
ANLLKPALARGQLRTIGATTWSEFKRHIEKDPALTRRFQVLQVDEPDENTAISMLRGLIPALEKHHGVWI
MDEALQAAVRLSHRYIPARQLPDKAISLLDTACARIAVAQFSQPIELQHLTFQSETAQTELVSLEKARHF
GKAQDARTEQLKTSIAEHGEAADKLDQRWQAERELVSAITTIRTALYDLVSQPEPDEEKRRAYQAQLVQL
EAQLSQVRTSLPLVQTEVNAEVIASIVADWTGIPVGQMLKDDIRAVMELPQRLEARVIGQPHALMQLGEN
IMTARAGLSDPRKPLGVFMLVGPSGVGKTETALAIAESMYGGEQNMITINMSEYQESHTVSSLKGSPPGY
VGYGEGGVLTEAVRRKPYSVVLLDEIEKAHSDVHELFFQVFDKGQMEDGEGRFIDFKNTILLLTSNVGSE
LLSNLLADPDTAPDQDGILSALQPELLKVFPAAFLGRVTVIPYLPLQQDALQHIVRLHLDRIGARLYSQH
QLTLKYSDEVVEDVVSRCAVSETGARMLIRYIEQNITPKIGKYILGDSDVKPEQIIFVHKNENGFVIALQ
CKDDEN
 
Nucleotide Sequence: 2751 bp     [Download]
>gi|384412706|ref|NC_017265.1|:1423821-1426571 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGGTGCATCAAGCATTATTTCATGAACAATTTAAACTACACATGAACGCCGTTAAAAAGACCAGGATAA
AAAACGTGGCTATTACAAGGAAACATCTCTTCGGCAAGCTGGACGCCACTCTTTTCAAAGGTATTGAAAG
CGCAACAACGATTTGTAAATTACGCGGCAATCCTTACGTAGAGTTAGTTCACTGGTTGAATCAGCTTTGG
CATCAGGAAGATAACGACCTTAAGCAGATTATTCGGTATTTTGCGGTGGATGTGGATGCCTTTGAGCGTG
AACTGGCTCAGGCACTTGCGAAGTTACCTGTTGGGGCAACTAGCATTTCAGATTTTTCGTATCATATTGA
GTTGGCCACGGAACGGGCTTGGATCTATGCCAGCCTGGAGTGTTTAGATACCCGTATCCGCAGCGGACAT
CTGCTGCTTGCGCTATTAACCACAATGGAACTGCGGAGAGCTTTCTTTGCGATTGCGCCAAGCATGGAAA
AAATTCCATTAGAGCATTTAAGCAAAGATTTGAACTTCATTACGCAGGCATCACCAGAAGCGAATGAAGC
CGCCAGTGATGGCAGCCCGTTGTACGATGGTGCTTTACCTGGCGAAGCCAGTAATGCCATTGGTGCAGCC
AAAAGTGGTGGCGCACTGGCTCAATACACCACAGACCTCACGGCATTAGCACGTGAAGGCAAGATAGATC
CGGTATTGGGACGTAATCACGAAATCAACACAATGGTTGATATTCTCTTGCGCCGTCGGCAGAACAACCC
ATTACTTACCGGTGACGCAGGGGTGGGTAAAACCGCCATTGTTGAAGGGCTAGCATTGGCTATTGCTGCT
GGCTCAATGCCACCAGCATTAAGCCAGGTAAGCCTGTTGTCATTAGATATTGTGGCGCTCTCAGCGGGTG
CCAGCATGAAAGGTGAATTTGAAGCGCGCCTGAAGAGTGTCTTGGATGAAGCGATAGCGGCAGAAAAGCC
CGTTATTTTGTTTATCGATGAAGTACACACACTTATTGGCGCGGGTGGCAATGCCGGGACCGGCGATGCG
GCGAACTTATTGAAACCTGCATTGGCGCGTGGCCAGTTACGTACCATTGGTGCGACAACGTGGAGCGAGT
TCAAGCGTCACATTGAGAAGGATCCGGCACTCACCCGTCGTTTCCAAGTACTTCAAGTTGATGAGCCCGA
TGAGAACACGGCGATCTCCATGTTACGGGGCCTGATACCTGCGCTAGAAAAGCACCACGGCGTGTGGATT
ATGGACGAAGCTTTACAGGCGGCAGTACGGTTGTCTCATCGTTATATCCCTGCGCGTCAGTTGCCGGATA
AAGCGATAAGTCTGCTTGATACGGCTTGTGCACGGATCGCTGTCGCGCAGTTTTCACAACCAATAGAGCT
ACAGCACTTAACCTTCCAGAGTGAGACGGCGCAAACTGAGCTGGTTTCCTTAGAGAAAGCGCGGCACTTT
GGTAAAGCGCAGGATGCGCGTACTGAGCAGTTGAAAACATCCATTGCTGAACATGGCGAGGCTGCGGATA
AGCTTGATCAGCGTTGGCAGGCAGAACGCGAATTGGTATCAGCGATTACGACCATAAGAACCGCACTGTA
TGACTTGGTTTCTCAGCCAGAGCCTGATGAGGAAAAACGTCGGGCTTATCAAGCGCAATTAGTTCAGTTG
GAAGCGCAGCTTTCTCAGGTTCGCACTTCACTGCCGTTAGTGCAGACAGAAGTCAACGCTGAAGTGATTG
CCAGTATCGTTGCGGATTGGACCGGCATTCCGGTTGGGCAAATGCTCAAAGACGATATTCGGGCGGTAAT
GGAGTTGCCACAGCGCCTTGAAGCACGTGTTATTGGTCAGCCCCATGCATTGATGCAACTGGGTGAAAAT
ATTATGACCGCACGCGCTGGCCTGTCAGACCCAAGGAAACCATTGGGGGTCTTTATGTTAGTGGGGCCTT
CAGGTGTGGGTAAAACAGAGACGGCCTTAGCGATCGCCGAGAGCATGTATGGTGGTGAACAGAATATGAT
CACTATCAATATGAGCGAATATCAGGAATCGCATACCGTTTCCTCTTTAAAAGGTTCTCCACCGGGATAT
GTTGGATACGGTGAAGGCGGTGTGTTAACGGAAGCTGTGCGCCGTAAGCCATATAGTGTTGTGTTGTTAG
ATGAAATCGAAAAAGCGCACTCTGATGTACATGAGTTATTCTTCCAAGTGTTTGATAAAGGCCAAATGGA
AGATGGTGAAGGGCGTTTTATCGATTTTAAAAATACTATCTTGTTGTTAACCAGTAATGTGGGCAGCGAG
TTACTGAGTAACTTATTAGCTGATCCAGATACTGCACCGGATCAGGATGGAATATTAAGTGCGTTGCAAC
CTGAATTGCTGAAAGTTTTCCCCGCAGCATTTTTAGGGCGAGTTACGGTTATTCCTTATCTTCCGTTACA
GCAAGATGCATTGCAGCATATTGTACGGTTGCATTTAGATCGGATTGGCGCTCGTTTATACTCGCAGCAT
CAATTGACACTGAAATACAGTGATGAAGTGGTTGAAGATGTTGTTAGCCGCTGTGCGGTCTCAGAGACCG
GTGCGCGTATGCTGATCCGTTACATTGAACAAAATATTACGCCAAAAATAGGTAAATATATTTTAGGTGA
TAGTGATGTGAAGCCTGAGCAAATTATTTTCGTTCATAAAAATGAAAATGGATTCGTGATCGCTTTACAG
TGTAAAGATGACGAAAACTAA
 Primer design