SecReT6
Protein ID: 384414010
SecReT6 ID590
T6SS typei3
Gene symbol-
Locus tagYPC_1462
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]1436170..1436730 [+]
Productputative exported protein precursor
NoteTssJ
UniProt IDE8P3W4
KEGG IDyph:YPC_1462
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.00E-36, Aligned region: 29..179
Protein Sequence: 186 a.a.     [Download]
>gi|384414010|ref|YP_005623372.1| putative exported protein precursor [Yersinia pestis biovar Medievalis str. Harbin 35]
MILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIA
LYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAE
WKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 561 bp     [Download]
>gi|384412706|ref|NC_017265.1|:1436170-1436730 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGATTTTAATTAGGCTAAGTATGAATAAAAGTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTT
TGGTACTGGTAACGTTATTGACGATAGCCTGTAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAGCTTAC
CGTCGAAATCGCGACAGCAGCGGATATTAATCCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCA
CTTTATACACTCAAGAGCACCGATGAATTTCAGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGC
CATCGCTAAAAGAACAAATGGATAACGTGTTTGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGA
GCTGACACTTGATGCTGGCGTTACTGCTATCGGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAG
TGGAAAGCGGTTATTTATCCGTTGCCCAAAAAACGCGTGGATCCTTGGTATAAAAAAATGTGGCCAGGGC
AAGACCAACAAGATCCGATCATGAAGGTACGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTA
A
 Primer design