SecReT6
Protein ID: 384414012
SecReT6 ID590
T6SS typei3
Gene symbol-
Locus tagYPC_1464
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]1438116..1438748 [+]
ProductFlagellar motor rotation protein motB
NoteTssL
UniProt IDE8P3W6
KEGG IDyph:YPC_1464
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-29, Aligned region: 74..186
Protein Sequence: 210 a.a.     [Download]
>gi|384414012|ref|YP_005623374.1| Flagellar motor rotation protein motB [Yersinia pestis biovar Medievalis str. Harbin 35]
MPPFDRSRNVDESPQALGRFLLDEPMTSPDSTQDNTAFTREAPHSGAAQQYDTTLLRGESVQQRVAKVLA
SSTPLLEAAQPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMAIVRYCLCTALDE
AAHTMSWGMMAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYAVTNGAIVIHTQRLKSDPGGSLLS
 
Nucleotide Sequence: 633 bp     [Download]
>gi|384412706|ref|NC_017265.1|:1438116-1438748 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGCCTCCTTTTGATAGAAGCAGAAATGTGGATGAGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATG
AGCCAATGACATCCCCAGATAGCACTCAGGATAATACGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGC
GGCACAGCAATATGACACGACCCTCTTACGGGGTGAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCA
TCTTCAACGCCATTATTGGAAGCGGCACAGCCACTATTACGTGCCTTGAGCGAGATGCCCGCGCATATTG
GGGATGTTTCACAGGTTCATATATTAAAACAAAGCCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTG
TGATGAAGCGGATATCTCATGGAAAAAAATGGCTATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAA
GCCGCTCACACGATGTCGTGGGGAATGATGGCAGGTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAG
GCGATAATGACGGCGGGAATAAGTTTTTCTTATTGGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGC
TGTAACGAACGGTGCAATAGTGATCCACACCCAACGCCTGAAATCAGATCCAGGGGGTAGTCTGCTCTCC
TGA
 Primer design

Protein ID: 384414015
SecReT6 ID590
T6SS typei3
Gene symbol-
Locus tagYPC_1467
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]1440579..1441415 [+]
Productputative OmpA family protein
NoteTssL
UniProt IDE8P3W9
KEGG IDyph:YPC_1467
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.90E-18, Aligned region: 18..111
OmpA [PF00691], Evalue: 1.70E-16, Aligned region: 172..270
Protein Sequence: 278 a.a.     [Download]
>gi|384414015|ref|YP_005623377.1| putative OmpA family protein [Yersinia pestis biovar Medievalis str. Harbin 35]
MGRWWRYKWITFHPSLTYADGLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALS
PHGLIAHQNRRRRGIFVPVRVSMLLCGFLIVATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLR
LSILLKDEIAKQLVSVDETSNNSKVIFKGDSMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDS
MPINKPGFPNNQVLSEKRAANVARYMEQAGIPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 837 bp     [Download]
>gi|384412706|ref|NC_017265.1|:1440579-1441415 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
TTGGGCCGTTGGTGGAGATATAAGTGGATCACTTTTCATCCGTCGTTGACATATGCGGATGGTTTAGAGG
TTTTGCTGCGCATTTTAGGGCTCGGTTTTGAGGGGCGCTACAGCATTATCGAAGATGGTGATCGGCAATT
AACTAAAATACGCCAAGGGTTGCTGACGCTGCTCCAAAGTACCCGAGACACGATCCCACCGGCACTTTCT
CCGCATGGGTTGATCGCACATCAAAACAGAAGACGGCGGGGCATTTTTGTTCCGGTGCGCGTATCCATGC
TGTTGTGTGGTTTCCTCATTGTCGCGACCTTTATTGGATGTAAATACTTTCTCTCGGTACCGGAAAGTGA
CTTGCTAAAAAGAATGGGAGCATTGCAACGTGTGGTTGTGACGCCACCCGTTGCCGCACCAAAACTTCGA
CTGTCTATTTTATTAAAAGATGAGATAGCGAAGCAGTTAGTCAGTGTTGATGAAACGAGCAACAACAGCA
AAGTCATCTTTAAAGGCGACTCTATGTTTATGGTCGGCTCGGATAACGTCAGACCTGAAATGATTGACGT
AATTAAACGCGTCGCGCAGGAAGTGCATCGCGTTAAAGGGGCAATCCTCATCGTCGGGCATACAGACTCT
ATGCCGATTAATAAACCCGGCTTCCCTAATAACCAGGTACTTTCCGAAAAACGCGCGGCCAATGTTGCAC
GCTATATGGAGCAGGCCGGTATTCCAACCGACAAAATTCGGTTTGAGGGCAAGGGGGAAACGCAACCGGT
TAGCAGCAATGACGATGCGACAGGACGTTCGCAAAACCGCCGCGTAGAAATTTTTGTTAATTATTGA
 Primer design