SecReT6
Protein ID: 384414017
SecReT6 ID590
T6SS typei3
Gene symbol-
Locus tagYPC_1469
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]1441424..1443829 [+]
Producthypothetical protein
NoteTssM
UniProt IDE8P3X1
KEGG IDyph:YPC_1469
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-72, Aligned region: 251..536
IcmF-related [PF06761], Evalue: 1.60E-58, Aligned region: 584..800
Protein Sequence: 801 a.a.     [Download]
>gi|384414017|ref|YP_005623379.1| hypothetical protein YPC_1469, partial [Yersinia pestis biovar Medievalis str. Harbin 35]
MSYLNRLFSGWAMKRILLVGCFILLAAAIWFLGPFLGFGEARPLESYEARIICILLALLLILGFWYGAPR
FVIAAVVACAAVWVIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTWCLVKALAKNPALLDNFIKHK
KAAKPEAEAELSEVNAMIRNGMNYVRRIHSGIPAWRRFFISNRWRTELPWFMVVGMKGAGKTALILSSGQ
DFPLPEQLNRIGKENPPTQHCECLFSNDALFLDTSGKYIDDSKDNQTEWTGILKALKKYRPVKAINGVIV
AISASDILGKSKADLLNVSATLRTRLDEVRAVLGVRFPVYVTITKLDQISGFDEYFRNLTAEDREQIWGV
TFPYNEAKEQSDMPLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQN
VFFASRFDETKFHTTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQKSDNEDRFISD
VAYGKQYFLKQLFSDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAVWLVWAFLVSFQHNEGYLQAT
GAKLSQLESTVMSYAKTSNEQILPALLNATQQLPEYGTLDVANPELDWRYGLYTGSAISQGANTLYQFFL
QKYLFPMVENQSEVTLRKTMHSGQSEEVYAALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKS
IFVGHLNTLFTLKDWRQYGQPADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHAT
QVFTLSDDELLHEGIPGLYTYAGYHEVVKKN
 
Nucleotide Sequence: 2406 bp     [Download]
>gi|384412706|ref|NC_017265.1|:1441424-1443829 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGTCTTATTTGAATCGATTGTTTTCTGGCTGGGCCATGAAACGCATATTGCTGGTCGGCTGCTTTATAT
TGCTGGCTGCGGCGATATGGTTTCTGGGGCCTTTCCTCGGCTTTGGTGAGGCGCGGCCTCTCGAAAGTTA
TGAAGCCAGAATTATTTGCATCCTGCTGGCACTGCTGCTGATCTTAGGTTTTTGGTACGGCGCACCGCGC
TTTGTCATTGCCGCCGTCGTTGCCTGTGCTGCGGTATGGGTGATTGGCCCATTCATATTAGTTGGTGATG
ATCATCCTCTGACTGATGGGATCCGTCGCGGCATCATTATCGCCATCATTGCATTTATTACACTTATTTA
TGGCACCTGGTGCTTAGTCAAAGCATTGGCGAAAAATCCAGCGTTACTGGATAACTTCATTAAGCACAAG
AAAGCGGCCAAGCCTGAAGCGGAGGCTGAACTTTCTGAAGTTAATGCGATGATCCGCAATGGCATGAACT
ATGTGCGCCGTATTCACAGTGGTATTCCGGCCTGGCGACGTTTCTTTATCTCCAACCGTTGGCGCACAGA
ACTGCCTTGGTTCATGGTTGTCGGTATGAAAGGTGCAGGGAAAACCGCCCTTATCCTCTCTTCAGGACAG
GACTTTCCTTTACCTGAGCAGCTGAATCGTATTGGCAAAGAAAACCCACCCACTCAACATTGTGAATGTT
TGTTCTCTAATGACGCCCTGTTTTTAGACACTTCAGGGAAATACATTGATGACAGCAAAGATAATCAGAC
TGAGTGGACCGGGATATTAAAGGCACTCAAAAAATATCGTCCGGTTAAGGCAATTAATGGTGTCATTGTT
GCGATTTCGGCATCCGATATCTTGGGTAAAAGTAAAGCTGATTTACTGAATGTGTCGGCGACGCTACGCA
CGCGTTTGGATGAGGTTCGTGCGGTCTTGGGCGTCCGTTTCCCGGTGTATGTCACGATTACAAAACTGGA
TCAAATATCGGGTTTTGATGAATATTTCCGTAATTTAACGGCTGAAGATCGCGAGCAAATTTGGGGGGTG
ACTTTCCCTTATAACGAGGCGAAAGAGCAATCCGATATGCCACTTCAGCAACGTATCAGCCATGAGCTGG
CACTGCTTGAGGATCGTATCAGCAATAATATGCACGTCCGCCAGCAGGAAGAGTATGCCGTGGCGGACAG
AAAAGGCATGTATGCACTCCCTCAGGATTTCAGGATGCTCTCCCAGAGGGTAACGGAAGTTTTACAGAAT
GTTTTCTTCGCCTCACGCTTTGACGAAACAAAATTTCACACGACCCTGAGAGGGATCTATTTTGTCAGCA
GTTGTCAGCCTGCGGATGTTGAACTGTTAAATAACAACACGCTGATTCAAAAGTGGCGTAACGTTATTAA
TCATAAAAAACCGTTATCGCCAGCCGATTTATCACAAAAAAGTGATAATGAAGATCGGTTTATTAGCGAT
GTGGCTTACGGGAAACAATATTTCCTCAAGCAGTTGTTTAGCGATGTGATTACCAAAGATGCCGACTTAG
TCAGCTATAACCTGAAAGTACAATCCAAATACCGTTTTCAGAATCTATTGGGACACGCGGCTTGTATTGG
GTTGGCAGTTTGGCTGGTTTGGGCCTTCTTGGTCAGCTTCCAGCATAACGAGGGGTATTTACAGGCGACC
GGTGCCAAGCTGAGTCAGTTAGAAAGCACGGTGATGAGTTATGCCAAAACGTCCAATGAGCAGATCTTAC
CTGCGTTATTGAACGCGACACAGCAGTTACCCGAGTACGGTACGCTGGATGTGGCTAACCCTGAGCTTGA
CTGGCGTTATGGCTTATATACCGGTAGCGCAATCTCACAAGGTGCGAACACGCTCTATCAGTTTTTCTTG
CAAAAATATCTCTTCCCAATGGTTGAGAATCAGAGTGAGGTTACATTAAGAAAAACGATGCACTCAGGTC
AGAGCGAAGAGGTTTATGCCGCGCTGAAGCTTTATTTGATGCTGACGGGTGAAGGTAAATTTGATCGTCA
ATATATGATTGAGCACGTGACCCAAGATTGGCAGAAAAGTGGAAAAATTGAGCCTTACGAAGAGAAGAGT
ATTTTCGTCGGTCATTTGAACACGCTGTTTACCCTGAAAGACTGGCGGCAGTATGGGCAACCGGCAGACA
GTGAACTGATTAAGCAGGCTCGGGCAATACTGGCGGAAAAAACAGTGACCGCCAGACTTTGGGGGCGTAT
TCAATCCCGCTTATTGGCCGATGCCCCTGCCAATATGACGTTACGTAAAATGGTGGGTGAGCACGCGACA
CAGGTATTCACCCTGTCAGATGATGAACTACTGCATGAAGGGATCCCGGGGCTTTATACCTACGCGGGCT
ACCATGAGGTGGTTAAAAAAAACTGA
 Primer design

Protein ID: 384414018
SecReT6 ID590
T6SS typei3
Gene symbol-
Locus tagYPC_1470
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]1443835..1445250 [+]
Producthypothetical protein
NoteTssM
UniProt IDE8P3X2
KEGG IDyph:YPC_1470
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 9.10E-30, Aligned region: 210..323
IcmF-related [PF06761], Evalue: 3.30E-18, Aligned region: 2..95
Protein Sequence: 471 a.a.     [Download]
>gi|384414018|ref|YP_005623380.1| hypothetical protein YPC_1470, partial [Yersinia pestis biovar Medievalis str. Harbin 35]
MLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQGYAAYWKRFLSSVRLISVDADSAEYAQGLSLDIA
LLRTLVSENSPLLNLARQAVKETTLAEKEKAITDEINIRTQGQLLSQAKKLQETIAFRENKLIKEWVDNR
FESLRVFVNGEQSADVTGGNNLSVLQGTQMSRIIGTLNDQYTRFVVYNSAFEYGDIPPLSQDGERIAVES
QTWPDPFRNIIAPLLTGSSQKFENKVITHTSKAIDMGVGEICRNTLQGRYPFAESEQIVSLNDFERFFGT
DGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAFFEQAAMIRNVLFNTNDGKKMALDFSVSVRYLAPT
ITQLIMNFDGNTVRYSHGPVTPAFFKWPGLRQGTIVSLTAQRQKASAMPDILFRGPWALLQWADQADEIR
DEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLLRDFKCPSVNDMNGIW
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|384412706|ref|NC_017265.1|:1443835-1445250 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
TTGCTGATGTTACTTCAGGAAGAGGATAGGTGGGTGATGGCGCAATCGCTGTCATCTTCTCTTGACCCCC
TGACGTTAAGACAAGATGTTCTGGTGATGTATTTACAAGGGTATGCCGCTTATTGGAAACGCTTTCTCTC
CAGTGTTCGTCTGATTTCTGTCGATGCGGACAGTGCAGAGTATGCTCAAGGGCTGTCTCTGGATATTGCT
TTGTTAAGGACGTTAGTTTCAGAAAATTCACCGCTACTCAATTTAGCCAGGCAGGCGGTAAAAGAAACGA
CACTCGCCGAAAAAGAAAAAGCCATTACTGATGAGATAAACATCAGAACGCAAGGGCAATTACTCAGCCA
GGCTAAAAAATTACAAGAAACGATCGCGTTTCGTGAAAATAAACTGATTAAAGAGTGGGTTGATAATCGT
TTTGAATCCCTGAGAGTCTTTGTTAATGGGGAACAGAGTGCTGATGTCACGGGGGGCAATAATCTTTCTG
TTCTTCAGGGAACGCAGATGAGCCGAATAATCGGGACATTAAACGATCAATATACCCGTTTTGTTGTTTA
TAACAGTGCCTTTGAATATGGCGATATTCCTCCGTTATCCCAGGATGGGGAACGTATTGCGGTGGAATCA
CAAACATGGCCGGATCCGTTTAGAAATATTATTGCACCGTTATTAACGGGCTCATCCCAGAAATTTGAAA
ATAAAGTGATTACTCACACGTCCAAAGCGATTGATATGGGGGTGGGGGAAATTTGCCGGAATACGCTGCA
AGGGCGTTACCCATTTGCTGAAAGTGAGCAAATTGTTAGTTTGAATGATTTTGAGCGTTTCTTCGGTACT
GACGGTACGGTGGACAGTTATTTCAAGAAAAACTTGGAGAGTAAAGTCGACACGTCCTCAATACCTTGGC
GTTATAAGGGCAGCGTAAGTAGTGAAGGTTTGGCGTTCTTTGAACAGGCGGCAATGATCAGAAACGTGCT
ATTTAATACCAATGACGGTAAAAAAATGGCATTAGATTTTTCCGTATCAGTGCGTTATTTAGCACCCACT
ATCACCCAACTTATTATGAACTTTGATGGTAATACTGTGCGTTATTCCCATGGTCCCGTAACGCCAGCCT
TCTTTAAATGGCCGGGTTTACGTCAAGGCACCATTGTCAGTTTAACGGCCCAACGCCAGAAGGCATCCGC
GATGCCCGATATTCTTTTTCGCGGACCTTGGGCACTCTTGCAGTGGGCTGATCAGGCCGATGAAATTCGC
GATGAAGCGAATGGCAAACAGACGCTGACTTATCTCATGGGGAAAGATCGTGTCGAGCTTGAAGTCTCAG
GTTTAACGCATGGTGGTGAAACCATTAGCGATCTGCTGAGAGATTTCAAATGCCCCAGTGTCAATGACAT
GAATGGTATTTGGTAA
 Primer design