SecReT6
Protein ID: 384414019
SecReT6 ID590
T6SS typei3
Gene symbol-
Locus tagYPC_1471
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]1445544..1448129 [+]
Producthypothetical protein
NoteTssI
UniProt IDE8P3X3
KEGG IDyph:YPC_1471
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.80E-76, Aligned region: 29..347
Phage_base_V [PF04717], Evalue: 3.70E-24, Aligned region: 387..480
Protein Sequence: 861 a.a.     [Download]
>gi|384414019|ref|YP_005623381.1| hypothetical protein YPC_1471 [Yersinia pestis biovar Medievalis str. Harbin 35]
MSRTINLSSPAMPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDLKSLIGKEMTI
EMELDGNGLGDVRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDII
EEVFSDYNFPFEKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGAHKRS
FSTAYHAIEYLSDEPKAGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHW
PGDYDQPDIGEHLSRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVD
QLSGGEDAFSCESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGT
NSESDSCWLRVSQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLPANATQSGM
VSRTVGGGLTNYNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADSVLNVGANRSEVVGANYNQDV
LGTSMLAIGAASMLQVGLARSVVVGGAHSLNVVLANATNVGGANMTNVGGFNGLAVGGAHQTAVGGAATL
AAGGPIAIGAGGELILSGDIVKIVGKSKVIIQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGA
IALPLPLPLLPIVVPPVTSPPDPTVPPDPTLPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPETTAPPE
TTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAP
PETTAPPEPTRTPPGTQTPPP
 
Nucleotide Sequence: 2586 bp     [Download]
>gi|384412706|ref|NC_017265.1|:1445544-1448129 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGTCAAGGACAATAAATTTGAGCAGCCCGGCTATGCCTTATCTATTGGGTGAGCCTGCGCTGGTACTGT
CTAAGTTGGAAGGCGAGGAAGCCTTTTCGACTTTATATTCTTATACTATTACGGCAAAGACACCGGCTAA
CCCATTAATTCCTTGGCAAGCGGCTTCAAATGTCGATCTCAAATCCTTAATTGGTAAAGAGATGACGATT
GAAATGGAACTGGACGGCAACGGCCTGGGTGATGTGAGAAGTGTAGGTAAAGGCACGCGTGAAATTACGG
GGCTGGTTGAGAGAGCCAGATACATTGGTCGAGATGCCAATCAGGCCATATTTGAGATCACTATTAAGCC
TTGGTTCTACCTGGCTAATTTAACCTCTGACTTTAAAATTTATCAAAATAAAAATGTCGTTGATATTATA
GAGGAAGTGTTCTCAGACTATAATTTTCCGTTTGAGAAACGGTTGGCTACAACCTATCCGATATTAGATT
TTCAGGTTCAGTACGGTGAAACCGACTTTAATTTCCTTCAGCGTTTGATGGAAGAGTGGGGTATTTACTG
GTTCTTTGAGCATCAGGATCATAAACAAAAATTAATTCTTGTGGATCATGTCGGTGCGCATAAACGCTCG
TTCAGTACCGCCTACCATGCCATTGAGTACTTGTCGGATGAGCCTAAAGCGGGCGAAGAGTACATCACAC
AATTCCAGACTCAGGAAACCTTGACGAGTGGGACCTGGGTCACCAACGATTATGACTTCACGAAATCCCG
TGCCGATATTCTGGCAATGGACAGTAAACCGCGTAAAACCAGCTTTAACGATCTCGAGATTTATCACTGG
CCAGGGGATTATGATCAGCCAGATATTGGTGAGCACCTTTCACGCGTGCGTATCGAAGAACGTGGTGCTC
TGGGTTCGCGGGCGGTCGGTTCTGGTCAACTGCGCGGGATAGTTTGTGGTGCTAACTTCGAGCTGAAAGG
GTTCCCCGTTGATAAAGCGAATCGGGAATACATGATTATCTCCAGCCGTTTGACGGTGGCTGAAGTTGAT
CAACTGTCTGGCGGTGAGGATGCGTTTAGTTGCGAGAGTTCTTTCACGGTTCAGCCGACGACCAAAATCT
ATCGTCACCCACAGGTGACACCAAAACCGAAAACCAATGGGCCGCAAAACGCCATTATTGTGGGGCCACC
GGGTGAAGAGATTTGGACCGATGAATATGGCCGCGTAAAAGTGCGTTTCGTTTGGGATCGCTATGGCACA
AACAGCGAGTCAGACTCTTGCTGGCTACGTGTTAGCCAGGCTTGGGCAGGGAACAGCTTTGGTGGGATCT
ATATTCCACGCATTGGTCAGGAAGTCATTGTTGACTGTATTAACGGCGATCCTGACCGGCCAATGGTGAT
GGGCAGCCTTTATAATAACGTGACGCGTCCCCCTTGGGACCTGCCTGCCAATGCGACGCAAAGTGGCATG
GTCAGTCGTACCGTTGGCGGCGGGTTAACCAACTATAACGGCGTTCGTTTTGAAGATAAATCGGGGCTGG
AGCAGTACTGGGAACAGGCCGAGCGCGATATGTCGCGTTTGACTAAAAATAATGAAACGCAAATTATCGG
TGCCGATTCTGTCCTGAATGTAGGGGCCAACCGAAGTGAAGTTGTCGGGGCCAATTATAACCAAGATGTT
CTTGGCACATCAATGTTAGCCATCGGTGCAGCCTCTATGCTACAGGTGGGATTGGCGCGTAGCGTTGTGG
TTGGCGGAGCACATTCACTGAATGTGGTTTTGGCGAATGCCACCAATGTGGGTGGCGCTAACATGACCAA
CGTAGGGGGGTTTAATGGCCTTGCGGTGGGGGGAGCCCATCAGACAGCTGTAGGCGGTGCTGCGACACTG
GCTGCCGGCGGCCCTATTGCTATTGGGGCGGGTGGTGAGCTTATCCTCAGTGGGGATATCGTAAAAATTG
TTGGTAAAAGTAAGGTTATTATTCAGGGCGGTGAAGTTCACATTAACTCTGATGATTGTTGTGGTCGTAA
AACGGGCAATGGCGGCGGGGCATTCGGTGCCTTTGCGAGCCTGGCAGGTTTATTGCCGCTGGCGGGTGCT
ATTGCCTTACCGCTACCGTTACCCTTGTTGCCAATAGTGGTGCCACCAGTGACATCGCCACCGGATCCAA
CAGTGCCACCGGATCCGACATTGCCACCGGATCCGACATTGCCACCAGATCCAACGTTGCCACCAGATCC
AACGTTACCGCCGGAAACCACGGCACCGCCGGAAACCACGGCACCGCCGGAAACCACGGCACCGCCAGAA
ACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACCACGGCACCGCCGGAAACAACGGCACCGCCAG
AGACAACGGCACCGCCAGAGACAACGGCACCGCCAGAAACAACGGCACCGCCGGAAACAACGGCACCGCC
GGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACCACGGCACCGCCAGAGACAACGGCACCG
CCAGAGACAACGGCACCGCCGGAACCGACGCGAACACCGCCAGGGACGCAGACGCCACCGCCTTGA
 Primer design