SecReT6
Protein ID: 384414023
SecReT6 ID590
T6SS typei3
Gene symbol-
Locus tagYPC_1475
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]1450307..1450786 [+]
Producthypothetical protein
NoteTssE
UniProt IDE8P3X7
KEGG IDyph:YPC_1475
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-16, Aligned region: 35..138
Protein Sequence: 159 a.a.     [Download]
>gi|384414023|ref|YP_005623385.1| hypothetical protein YPC_1475 [Yersinia pestis biovar Medievalis str. Harbin 35]
MEKKKQFLPALLERLLDDEPKKHIEPHDKFFYDSRTMRKLVQRNISEILNNANIEDRLDPQRHKWVATSV
LNYGISPLVGLYAVPHNWATIERIIREAIIRFEPRIMAESLVVSQQLQARNGIIQFEIRGLIKWNPHPID
LCIEGAYDVETDNAELRAR
 
Nucleotide Sequence: 480 bp     [Download]
>gi|384412706|ref|NC_017265.1|:1450307-1450786 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
ATGGAAAAGAAAAAACAGTTTTTACCGGCGTTGTTAGAGCGTTTACTCGATGATGAGCCTAAAAAGCATA
TTGAGCCTCACGATAAATTCTTTTATGACTCACGGACGATGCGGAAATTGGTACAACGTAATATTTCAGA
GATATTAAATAATGCCAATATTGAAGACCGGTTGGATCCGCAGCGTCATAAATGGGTAGCGACGTCGGTC
TTAAACTATGGTATTTCACCCCTGGTCGGGCTTTATGCCGTGCCGCATAATTGGGCGACTATTGAACGAA
TTATCAGAGAGGCCATTATCCGTTTTGAACCACGGATAATGGCGGAATCTCTCGTTGTCAGCCAGCAACT
CCAGGCCAGGAATGGCATTATACAGTTTGAGATTAGGGGGTTAATCAAATGGAACCCGCACCCTATCGAT
CTTTGTATTGAAGGTGCCTATGACGTTGAGACGGATAACGCAGAGCTACGCGCCCGTTGA
 Primer design