SecReT6
Protein ID: 384416381
SecReT6 ID592
T6SS typei3
Gene symbol-
Locus tagYPC_4028
StrainYersinia pestis biovar Medievalis str. Harbin 35
Repliconchromosome [GenBank: NC_017265] [Browse all T6SS(s) in this replicon]
Location [Strand]3890344..3893796 [+]
Producthypothetical protein
NoteTssM
UniProt IDE8P3B9
KEGG IDyph:YPC_4028
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.80E-75, Aligned region: 484..782
ImcF-related_N [PF14331], Evalue: 3.50E-29, Aligned region: 81..100
ImcF-related_N [PF14331], Evalue: 3.50E-29, Aligned region: 180..361
DUF1215 [PF06744], Evalue: 4.20E-29, Aligned region: 891..1010
Protein Sequence: 1150 a.a.     [Download]
>gi|384416381|ref|YP_005625743.1| hypothetical protein YPC_4028 [Yersinia pestis biovar Medievalis str. Harbin 35]
MLYCVVDRAADRHWPLFPSGGVWVRKIIIALILFWALWPFVAIFFSWIFRYARAPLPKRKKKTVQLDRVS
ARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDAKPWFLVMGPPGCGKTSIVYESSEKFLLSEQYGLA
QTTDIGPTQDCNWWLTDRAVYIDTAGEWILLHGQSEEAGTARQKLFSMIRKYRRYPGVDGIVLCLDVSVL
LNSSVTERKSLADTLRLRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDELLAGGLGISMTHNEK
GQNNFVADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGLFEQIFPATPIGYTG
CLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGPMPLRNRLLNIGKYV
FVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQVNDNLVAAYEQLGYINTHYLESSP
PLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYVTNELKKDTQSPDGDNYDTLKVYLMLGQPDHRSQE
ALVQWFMSRWESFAPQGYGQNDRKLFSYHLSELFSDTASAAPKVKLNDELIRESRIKAMKTPIHIRVINR
IHDAPLPARIEDLSLADAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQLQEASEAMINEEAW
VLSDGKASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAALLARQLSDPSSPLA
NLVRFSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTPEKAVEDRFELLRRL
GYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFSRLQIDMARQPEPVRSIMMDLLAVG
QTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNWLASEEIGIGDFNRMFGRSGAMQSFFDQNLAPYVD
TNGNRWKVKPDSNGVVTPKTLRSFENSAQIRDTFFDASGKMAMSMIIRPISLTPSILEAVLDVDGQIINY
SHGSNQPVKVDWPGPKGGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLGVNSRELMMVMDNVS
GVFKIELSSTMKDYPLWSKALAQFSCPKNL
 
Nucleotide Sequence: 3453 bp     [Download]
>gi|384412706|ref|NC_017265.1|:3890344-3893796 Yersinia pestis biovar Medievalis str. Harbin 35 chromosome, complete genome
TTGTTATATTGTGTGGTGGATAGGGCCGCTGATCGCCATTGGCCCCTATTTCCCTCTGGGGGGGTATGGG
TTCGTAAGATCATTATTGCTCTGATTTTATTTTGGGCACTGTGGCCATTTGTTGCAATTTTCTTCAGTTG
GATTTTTCGTTATGCCCGTGCGCCACTTCCCAAGCGCAAGAAAAAAACGGTTCAGCTTGATCGCGTTTCT
GCACGTTTTCATGATGCGATGCTCACCCTGCAACATGCGGATCTTTCAAGCCAGAAAACACGCTGGCAGC
GCTGGCGTCAACGGCGTAAGCGCCAGTATATCGATGCTAAACCGTGGTTTCTGGTCATGGGGCCACCCGG
ATGCGGTAAAACGTCGATAGTTTATGAGAGTAGCGAGAAGTTCCTACTCTCAGAACAGTATGGTTTAGCG
CAGACCACGGATATTGGACCGACGCAGGACTGTAATTGGTGGCTGACGGATCGTGCTGTTTACATCGATA
CGGCAGGGGAATGGATCCTGCTGCATGGTCAGAGCGAAGAAGCGGGCACGGCTCGGCAAAAATTGTTCTC
TATGATCCGCAAATATCGCCGTTATCCGGGGGTTGATGGGATTGTTCTTTGCCTTGACGTCAGCGTGCTT
TTGAACTCTTCGGTGACGGAACGTAAGTCACTGGCTGATACGTTGCGCCTGCGGATCCTGGAAGTTGCCT
CGACATTTCAGGCCGATATTGCGGTGTACTTGTTCCTCAACAATATCGATAAGTTACCTGGCGGCGAAAC
CTTCCTCTCGTTAATGAACGACGAACTTCTGGCCGGAGGGCTTGGGATTAGCATGACCCATAATGAAAAG
GGGCAGAACAATTTCGTTGCCGATGAAGAACGTTACCGTGAACTCCTGACACGTGTTAGCCGTTATGTGT
TGGAAATACTGCACGATTCGCCCAACATGGAGATGCGCCACCAATTGCTGCTGTTTACAGAAAGCCTGGG
AGCGCTACAAAAACCCCTGTTTGGCTTATTCGAACAAATATTTCCGGCGACACCGATTGGCTATACCGGT
TGTTTGCGGCAGTTCTGGTTTGGCAGTACCCAAAATCTGACCTCATGGGAGGCGCTGTATTATCCGTCAT
CGACCAGCACCTTTGAAAGCCGGCCTGCTGGGCAGATGTATTTCCCTGCACTGAGTCAAGCGATCACCGA
AAGGGGGGTATTACACGCCACTGGCCCCATGCCTTTGCGAAATCGCCTGTTAAACATCGGTAAATATGTG
TTCGTGGTCCTTGTGCTCTGCATCTTATTGTTGATGCTGAGCGCCCGCTATTTTTGGGAATATGACTATA
TTGGCTATGCGACAGCTCGGTTTGAGGAAACCCGTCGGATTGTGCGTGACATCCCAATCACGAATCAGGT
CAACGATAATCTGGTCGCAGCTTACGAACAGTTGGGGTATATCAACACCCATTATCTGGAAAGTTCACCG
CCACTGCTGACACCGTACTTCGAGCACCGTTTACTGAATCAGGCGATGTTGCAAACCTACCATCGTCACC
TGAATAAAGTGTTCTGGCCTGCGGTACAAAACTACGTCACCAACGAGCTGAAAAAGGACACTCAATCTCC
TGACGGTGACAACTATGACACGCTGAAAGTTTACCTGATGCTCGGACAACCTGATCACCGCTCTCAGGAG
GCATTGGTGCAATGGTTTATGTCGCGCTGGGAAAGTTTTGCGCCTCAGGGATATGGGCAAAACGACCGCA
AACTCTTCAGTTATCATTTGAGTGAACTGTTTTCTGACACCGCCTCAGCTGCCCCGAAAGTTAAGCTGAA
TGATGAGCTGATCCGTGAATCACGCATTAAAGCGATGAAAACACCGATACACATCCGGGTGATTAATCGT
ATTCATGACGCCCCACTGCCCGCGAGGATTGAGGATCTTAGTCTGGCGGATGCCGCCGGTCCTAGCGTAA
CACTGATGCTGAGACGTAAAAGCCCCAGTACAGTAACGGATTTGGCGATCCCGGCTTTCTACACTCGGGC
CAGCTACCACGATGTGGTTAACCCACAACTTCAGGAAGCATCGGAAGCGATGATTAACGAGGAAGCGTGG
GTGTTGAGTGACGGTAAAGCTTCGGTTAGTCAGGTTAGTTTACTGGCTGCGGCGCAAAAACTGTCCGATG
AAGCGCGCAAGTATTATCTGATGGAGTATGCCAACCAATGGGATGCATTCTTCAATGATATCAGGGTGCG
CCCAATCAACGGACTTGATGATGCGGCGCTGCTGGCAAGGCAACTCTCAGACCCGTCATCCCCGTTGGCT
AATCTGGTGCGTTTCTCCACACGGGAAATAACCCTGACCACTGACAACAATGGTAAAGGGGCGATGTCGT
CAGGCTGGTTCAATATTCAACGTAATAAGCTCACGACTGCCCGCCGTAACATCATTGACGAAATGTCGGG
TGAGCGTTCTCGTTTTCGTCTAACGCCAGAGAAAGCGGTGGAGGATCGCTTTGAACTATTAAGACGTCTG
GGATATGCCCTGCAAAGTGCGTCTACCAGCAATTCTGATCCGTTGGGCCGAACCTTCGAGCAGATTTATA
ACCAGTTGATAACACTCTCGACTTCCCTTCGGGCTGGGCAGATTTTGCCGCAAAATAACGATTTCAGTCG
CTTGCAAATCGATATGGCCCGTCAGCCAGAGCCGGTGCGCAGCATTATGATGGATCTGCTGGCCGTCGGA
CAAACGCAAAGTCTGCAACAAAGTAAGGCCAACCTCAGCAAGGGCGTCTCTTCAATTGCTTCTGATTTAT
GTAGCAACGCCGTCAGTGGCCGTTATCCCTTTAATTGGTTGGCTAGCGAAGAGATAGGTATTGGCGATTT
CAACCGTATGTTTGGTCGTTCTGGGGCGATGCAAAGCTTCTTTGATCAGAATCTCGCACCGTATGTCGAT
ACCAACGGCAACCGCTGGAAGGTAAAACCTGACAGTAACGGTGTGGTGACCCCTAAAACTCTGCGTTCGT
TTGAAAACTCAGCACAAATCCGCGACACCTTCTTTGATGCCTCCGGCAAGATGGCGATGTCGATGATCAT
TCGCCCTATCTCACTGACTCCATCAATTTTGGAAGCGGTTCTTGATGTCGATGGCCAGATTATTAACTAC
AGCCATGGTTCTAACCAACCGGTAAAAGTTGATTGGCCAGGACCGAAAGGTGGGGTGTATATCCGCCTGA
CGTTCAAAACTCAGGATGGAAATGTGGAAACCGTTAGCTTCAATGGTCCGTGGGCTATTTTCCGCATGTA
TGACGTTAGTAACCCTAGGCCACTCGGGGTCAATAGCCGTGAACTCATGATGGTGATGGATAACGTGAGT
GGCGTCTTCAAAATTGAGTTGAGTTCCACCATGAAAGATTATCCGCTGTGGTCAAAAGCATTGGCACAGT
TCTCATGTCCTAAGAATCTCTAA
 Primer design