SecReT6
Protein ID: 384418302
SecReT6 ID594
T6SS typei4b
Gene symbol-
Locus tagXOC_1309
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]1282242..1285979 [+]
ProductImcF-related family
NoteTssM
UniProt IDG7THA7
KEGG IDxor:XOC_1309
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-74, Aligned region: 188..449
ImcF-related_N [PF14331], Evalue: 1.90E-74, Aligned region: 938..996
IcmF-related [PF06761], Evalue: 4.50E-48, Aligned region: 493..832
DUF1215 [PF06744], Evalue: 4.40E-25, Aligned region: 771..794
DUF1215 [PF06744], Evalue: 4.40E-25, Aligned region: 818..869
DUF1215 [PF06744], Evalue: 4.40E-25, Aligned region: 956..1071
Protein Sequence: 1245 a.a.     [Download]
>gi|384418302|ref|YP_005627662.1| ImcF-related family [Xanthomonas oryzae pv. oryzicola BLS256]
MFSNLRYYLRDYRLWMILGLLAAAAVAYFGTEGLREIGLWAAAVLAVCLTIWLLVWIVRRIIARRAARSL
DAMVQGEADRAVAAAQPANRADTEALRSRMLEAVKAIKSSRLGVLKGKAALYELPWYVIIGNPAAGKSTA
ILNSGLQFPFEDNRGNVIQGIGGTRNCDWYFTMTGIVLDTAGRYSVSVEDRLEWLTFLALLKKHRPRAPI
NGIIIAASIAELSGSKPEFAIELAKNLRQRVQEITQRLEVFAPVYVVFTKADLIAGFSEFFHNLDPSERE
NVWGATLPYDPTANTDALAAFDTHFDELAEGLKEMSLAHMAMQRGRQVSPGLLTLPLEFVGIKPALRTFI
ATLFEENPYQFKPVFRGFYFSSALQEGHSVHHASERVSRQFALQARAQSGEAVPSGQTAYFLKDLFRKVI
FTDKQLVRQYSSPHQNRLRYGVFLGGVAVLALALGLWTWSYTNNVQLVNNATKDLDQAVRVQANRVDLQS
RIDALLLLQDRLEQLDRYKQKGGITSGLGLYQGGNIRKKLLAEYYNGMRQVMLEPTTVNLESFLGQVVSE
RDRLGKAAGPQQAAQQDSVLYQDASPTDTNDAYNALKTYLMLGNRKHVESAHLTQQLTLFWRGWLDANRG
QMTREEMTRAAEKLMTFYVAQAEDAQWPQVQTKVTLVNDSREALTRVMKGQPAMQRVFAQIKARAAARFP
TVTVNALIGEEANSGAITGSYAISGAFSREAWEEYVKDAIKEAANTQLSTTDWVLDTSEQSDLSLAGSPE
HVARELVTAYKQEYAKEWRKFIQGISVAPFHGFDQALSRMNRIGDPANSPLRKLLEKINEQTIWDNPMAD
ALSKKASGGVVAWFQRVILRRDPADAGKAEQQPVGPIGKTFEGLARLMTKRTDQPAVIDAYFDKLAKLRT
RMNAIKNQGQIGVGARKLMQDTFSNEGSELSAALTLVDEQMLTGLDETQRDAMRPLLLRPLTQTFAALVP
PTENEINRVWAAQVYEPFRNGIGQRYPFNLNTDVDAAPGDVAAIFGASGAIAAFNKDALGTLVIQRGNLL
ESRRWAGIGITLSSELVANYGNWVSGQSGAVAKDVSIFELLPTPAVGAIEYTIDISGQTLRYRNTPPQWM
TMQWPNAGAVPGAKITAVTSDGRSVEMFNAPGDNGLGRLIKAAAQEPVDDATRRFTWSDQGVSISVQMRI
VQSAGKATGGGDWQRGLQLPATVAGSPTTVGADAPAAAAPPGSVPAGASAQEGGQ
 
Nucleotide Sequence: 3738 bp     [Download]
>gi|384417079|ref|NC_017267.1|:1282242-1285979 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGTTCAGCAATCTCAGGTATTACCTTCGCGATTACCGTCTCTGGATGATTCTCGGCTTGCTCGCCGCCG
CCGCAGTCGCCTACTTCGGCACCGAGGGCTTGCGCGAAATTGGCCTGTGGGCGGCGGCGGTGCTGGCGGT
CTGTCTGACGATATGGCTGCTGGTGTGGATCGTGCGCCGGATCATTGCGCGCCGCGCTGCGCGCAGCCTG
GATGCGATGGTGCAAGGCGAAGCCGATCGCGCGGTCGCCGCCGCGCAGCCGGCCAACCGCGCCGACACCG
AAGCGCTGCGCTCGCGCATGTTAGAGGCGGTCAAGGCGATCAAGTCCTCGCGCCTGGGCGTGCTCAAGGG
CAAGGCGGCGCTGTACGAACTGCCGTGGTACGTGATCATTGGCAATCCTGCGGCTGGCAAGAGCACCGCG
ATCCTCAATTCCGGGTTGCAGTTCCCGTTCGAGGACAATCGCGGCAACGTGATCCAGGGCATCGGCGGCA
CGCGCAATTGCGATTGGTACTTCACCATGACCGGTATCGTGCTCGATACCGCCGGTCGGTATTCGGTCAG
TGTCGAAGACCGCCTGGAATGGCTCACCTTTCTCGCGCTGCTGAAAAAGCACCGGCCGCGCGCGCCGATC
AACGGCATCATCATCGCCGCCAGCATCGCCGAACTGTCCGGTAGCAAGCCCGAGTTCGCGATCGAGCTGG
CCAAGAACCTGCGCCAGCGCGTGCAGGAAATTACCCAGCGCCTGGAAGTGTTCGCGCCGGTGTACGTGGT
GTTTACCAAGGCCGACCTGATCGCCGGCTTCTCCGAATTCTTCCACAATCTGGATCCGTCCGAGCGCGAG
AACGTGTGGGGTGCGACCCTGCCCTACGATCCGACCGCCAATACCGATGCGCTGGCCGCCTTCGACACTC
ATTTCGACGAACTGGCCGAAGGCCTCAAGGAAATGAGCCTGGCGCACATGGCGATGCAGCGTGGGCGTCA
GGTGTCGCCGGGCCTGCTGACACTGCCGCTGGAGTTCGTCGGCATCAAACCGGCGCTGCGCACCTTCATC
GCCACGCTGTTCGAAGAAAACCCCTATCAGTTCAAGCCGGTGTTCCGCGGTTTCTACTTCAGCAGCGCGT
TGCAGGAAGGCCATTCCGTGCACCACGCCTCAGAGCGGGTGAGCCGCCAGTTCGCGCTGCAGGCGCGTGC
GCAATCCGGCGAAGCGGTGCCGTCGGGACAGACCGCTTACTTCCTGAAAGACCTGTTCCGCAAGGTCATC
TTCACCGACAAACAGCTCGTCCGGCAGTACTCCAGCCCGCACCAGAACCGCCTGCGCTACGGTGTCTTCC
TCGGTGGCGTCGCCGTGCTGGCGTTGGCGCTGGGTCTGTGGACCTGGTCGTACACCAACAACGTGCAACT
GGTGAACAACGCCACCAAGGATCTGGATCAGGCCGTGCGCGTGCAGGCCAACCGGGTCGACTTGCAATCG
CGCATCGACGCGCTGCTGCTGTTGCAGGATCGGCTCGAGCAGCTGGACCGCTACAAGCAAAAGGGCGGCA
TCACCTCCGGGCTGGGCCTGTACCAGGGCGGCAACATCCGCAAGAAGCTGCTGGCCGAGTACTACAACGG
CATGCGCCAGGTGATGCTTGAGCCGACCACCGTCAATCTGGAGTCGTTCCTGGGGCAAGTGGTCAGCGAG
CGCGACAGGCTCGGCAAGGCGGCCGGCCCGCAGCAGGCCGCGCAGCAAGACAGCGTGCTGTATCAGGACG
CGTCGCCGACCGATACCAACGACGCCTACAACGCGCTGAAGACCTACCTGATGCTGGGCAACCGCAAGCA
CGTGGAGAGCGCGCACCTGACGCAGCAGCTGACCCTGTTCTGGCGCGGCTGGCTGGACGCCAATCGCGGC
CAGATGACCCGCGAGGAGATGACCCGCGCGGCCGAGAAGCTGATGACGTTCTACGTCGCCCAGGCCGAAG
ATGCGCAGTGGCCGCAGGTGCAGACCAAGGTCACCCTGGTCAACGACAGCCGCGAGGCGCTGACCCGGGT
GATGAAGGGCCAGCCGGCGATGCAACGCGTATTCGCGCAGATCAAGGCGCGCGCGGCGGCGCGCTTCCCC
ACGGTGACGGTCAACGCGCTGATCGGCGAGGAAGCCAACAGCGGCGCGATCACCGGCAGCTATGCCATTT
CCGGGGCGTTCTCGCGCGAGGCGTGGGAAGAATACGTCAAGGACGCGATCAAGGAAGCGGCCAATACGCA
GCTCAGCACCACCGACTGGGTCCTGGACACGAGCGAGCAGAGCGACCTGTCGCTGGCCGGCAGCCCTGAG
CACGTCGCGCGCGAACTGGTGACGGCGTACAAGCAGGAATACGCCAAGGAGTGGCGCAAGTTCATCCAGG
GGATCAGCGTGGCGCCGTTCCATGGCTTCGACCAGGCGCTGTCGCGGATGAATCGCATCGGCGATCCGGC
CAACTCGCCGTTGCGCAAGCTGCTGGAAAAGATCAACGAGCAGACCATCTGGGACAACCCGATGGCCGAC
GCCTTATCGAAGAAGGCGTCCGGCGGGGTCGTCGCCTGGTTCCAGCGGGTGATCCTGCGCCGCGATCCGG
CCGACGCCGGCAAAGCTGAGCAGCAGCCGGTCGGCCCGATCGGCAAGACCTTCGAGGGCCTGGCGCGGCT
GATGACCAAGCGCACCGACCAGCCGGCGGTCATTGATGCCTACTTCGACAAGTTGGCCAAGTTGCGCACG
CGCATGAACGCGATCAAGAACCAGGGCCAGATCGGCGTCGGCGCGCGCAAGCTGATGCAGGACACCTTCA
GCAACGAAGGCTCCGAACTCAGCGCCGCGCTGACCCTGGTGGACGAGCAGATGCTGACCGGGCTGGATGA
AACCCAGCGCGACGCGATGCGTCCGCTGTTGCTGCGTCCGTTGACCCAGACCTTCGCCGCGCTGGTGCCG
CCGACTGAGAACGAGATCAACCGGGTGTGGGCGGCGCAGGTCTACGAACCGTTCCGTAACGGCATCGGCC
AGCGCTATCCGTTCAACCTCAACACGGACGTGGATGCCGCCCCCGGCGACGTGGCTGCGATCTTCGGCGC
CAGCGGCGCGATCGCCGCGTTCAACAAGGACGCACTCGGCACCTTGGTGATCCAGCGCGGCAACCTGCTC
GAATCGCGGCGTTGGGCGGGCATCGGCATCACCTTGTCCAGCGAACTGGTGGCCAACTACGGGAACTGGG
TCAGCGGCCAGTCCGGCGCGGTGGCCAAGGACGTCAGCATCTTCGAGCTCCTGCCGACGCCGGCGGTAGG
CGCGATCGAATACACCATCGACATCTCTGGCCAGACGCTGCGCTACCGCAACACCCCGCCGCAGTGGATG
ACCATGCAGTGGCCGAACGCCGGTGCGGTGCCCGGTGCCAAGATCACCGCGGTCACCAGCGACGGGCGCA
GCGTCGAGATGTTCAATGCGCCTGGCGACAATGGCCTTGGCCGCTTGATCAAGGCAGCCGCCCAGGAACC
CGTGGACGATGCCACCCGTCGCTTCACCTGGAGCGACCAAGGCGTGTCCATCAGCGTGCAGATGCGCATC
GTGCAGAGTGCCGGCAAGGCTACCGGGGGGGGCGACTGGCAGCGTGGCCTGCAACTTCCGGCGACGGTGG
CCGGTAGCCCGACAACCGTCGGTGCCGATGCGCCAGCGGCCGCTGCGCCGCCCGGTTCGGTTCCGGCGGG
TGCGTCCGCACAAGAAGGTGGCCAATGA
 Primer design